Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G14230-AT2G02970
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):GDA1/CD39 nucleoside phosphatase family protein
Function (paralog2):GDA1/CD39 nucleoside phosphatase family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.219913211627
Log2 mRNA fold difference:0.50774242193703
Log2 TE fold difference:0.55771325461458
Sequences
Protein sequence

MQRSNARSRSNINSDMVDPPEVQTSPGNHRSSPSTAAKPKSKRTKSIIFVIVACVTIALG
LLFIGYSILRSGRNRRVSLHYSVIIDGGSSGTRVHVFGYRIESGKPVFDFGEENYASLKL
SPGLSAYADNPEGVSESVTELVEFAKKRVHKGKLKKSDIRLMATAGMRLLELPVQEQILD
VTRRVLRSSGFDFRDEWASVISGSDEGVYAWVVANHALGSLGGEPLKTTGIVELGGASAQ
VTFVSTELVPSEFSRTLAYGNVSYNLYSHSFLDFGQDAAQEKLSESLYNSAANSTGEGIV
PDPCIPKGYILETNLQKDLPGFLADKGKFTATLQAAGNFSECRSAAFAMLQEEKGKCTYK
RCSIGSIFTPNLQGSFLATENFFHTSKFFGLGEKEWLSEMILAGKRFCGEEWSKLKVKYP
TFKDENLLRYCFSSAYIISMLHDSLGVALDDERIKYASKAGEEDIPLDWALGAFILNTAT
ATFDYSGKSRKILDLSNVAKYKI

MRRSHARSRVKNSSSSKSDMDPIKFQIRSGNRAPSSSSTYTLTKPNSKHAKSNLLLTVGS
ISVVLGVLFLCYSILFSGGNLRGSLRYSVVIDGGSTGTRIHVFGYRIESGKPVFEFRGAN
YASLKLHPGLSAFADDPDGASVSLTELVEFAKGRVPKGMWIETEVRLMATAGMRLLELPV
QEKILGVARRVLKSSGFLFRDEWASVISGSDEGVYAWVVANFALGSLGGDPLKTTGIVEL
GGASAQVTFVSSEPMPPEFSRTISFGNVTYNLYSHSFLHFGQNAAHDKLWGSLLSRDHNS
AVEPTREKIFTDPCAPKGYNLDANTQKHLSGLLAEESRLSDSFQAGGNYSQCRSAALTIL
QDGNEKCSYQHCSIGSTFTPKLRGRFLATENFFYTSKFFGLGEKAWLSNMISAGERFCGE
DWSKLRVKDPSLHEEDLLRYCFSSAYIVSLLHDTLGIPLDDERIGYANQAGDIPLDWALG
AFIQQTATETSQHAASGNLHWFHALFSNHPKTLHYLIGIPILMTVLVYLVTKWRKPQLKT
IYDLEKGRYIVTRIR

www.000webhost.com

Other information
Ka divergence:-0.314137KaKs divergence:-0.147604
GC content 1 (%):42GC content 2 (%):44GC content divergence:0.023
Length 1 (bp):1512Length 2 (bp):1668Length divergence:0.049
MFE 1 (kcal):-460.66MFE 2 (kcal):-519.8MFE divergence0.06