Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G14280-AT2G02950
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):phytochrome kinase substrate 2
Function (paralog2):phytochrome kinase substrate 1

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.87831263160811
Log2 mRNA fold difference:-0.85019265317923
Log2 TE fold difference:-0.014498341560889
Sequences
Protein sequence

MVTLTSSSSTPNVSFDFMMNNNNNSNNLYGPFSSSSTSFSYLTSKEDALTQKNLMSGITN
DVLGINKKASEDLEISVFGAEKYFNGDMDSDHSPRLVSPLPDPEVPIERIFVGPKQSSKN
SSETPSLRSESSWNSQSLLLQSKYVEKKKNIKKNSSCNSYFQEKDMSSNHKVSNKKSFLA
TLGCRCVCSNWSSVDVVDDKRRSSGLKKIKTQLSFSGDLSSEMKIHQQQQEAMLEQRKSL
EIFGSPLIEKRIIQKKFPWEYSSSAKKEEHGFSVKYEEEEDGSVSDVSTDLFEIESLTGK
ANPFLARQGSSDPDSPDGYAPSEVSIQWSVVTASVADFSVMSECATSPVKKNRSFQIPRI
PIMAKSNREIAPQRRKSSSSGLLMGCKSHKSVRVSGDSYTSMNRTPSYVPRFPVEANPTS
TETRRRISSSSVSHTQSPFLYT

MVTLTPSSASTPKTSFDFMKNNNSHSSLYVSSSSYLSSKEDALVTTKKLMEPSKTLNMSI
NPKQEEFGDEKKMVKKAPEDPEIGVFGAEKYFNGDMDSDQGSSVLSLTNPEVERTVVDSK
QSAKKSTGTPSVRSESSWNSQSVLLQNKLVNSCNSSFKEKKNSNGQIQKVTNNKKSFLAN
LGCKCACSDGDSVDVEEKTSVKRSADPNISVITMRSSADMNTELIKIQKQEELSQRKSLE
VFGSPVAIEKKSSVVQKKLPLPPWKSRTEEDDTKSEGSDSSSDLFEIEGLTGNPKPFLTR
QGSDPASPTCYAPSEVSVEWSIVTASAADFSVMSECATSPVRRNRPTQIPRIPITAKSAP
QRRKSSSSSGGNGFLMSCKSHKSVMVSGDLDRRSSMNKTQPSYVPRFPMETTKPKSFETR
RRISNSSISHTQSSLLYSQ

Other information
Ka divergence:-0.21695KaKs divergence:-0.402176
GC content 1 (%):41GC content 2 (%):43GC content divergence:0.024
Length 1 (bp):1329Length 2 (bp):1320Length divergence:-0.003
MFE 1 (kcal):-380MFE 2 (kcal):-385.65MFE divergence0.007