Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G14330-AT2G02870
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Galactose oxidase/kelch repeat superfamily protein
Function (paralog2):Galactose oxidase/kelch repeat superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.41902902541582
Log2 mRNA fold difference:0.25024177485847
Log2 TE fold difference:0.20060241211572
Sequences
Protein sequence

MVEDRTYLMSRIFSSSRLSESKWPYMYPQPEDSSESNLINGKRALENDVDELRQSKSPRL
MGFSIHGNEAIEEDEQEQDQSDSNNNGNSDGDSLINDIGRDNSISCLIRCSRSGYGSIAS
LNRSFRSLVKTGEIYRLRRQNQIVEHWVYFSCQLLEWVAFNPFERRWMNLPTMPSGVTFM
CADKESLAVGTDLLVLGKDDYSSHVIYRYSLLTNSWSSGMRMNSPRCLFGSASLGEIAIF
AGGFDSFGKISDSAEMYNSELQTWTTLPKMNKPRKMCSGVFMDGKFYVIGGIGGNDSKVL
TCGEEFDLETKKWTEIPEMSPPRSREMPAAAEAPPLVAVVNNELYAADHADMEVRKYDKE
SKKWFTLGRLPERADSVNGWGLAFRACGERLIVIGGPRSSGGGYIELNSWIPSSDRSPPL
WTLLGRKHSSNFVYNCAVMGC

MLEDRSPDSCLSTRVFSSSRLSESNWSNSYMYPEDDDKLLGNGKRALEVVGEVRQTKSLK
LMGFSIIYDSDSSDYSLSGGEEQADAAIGDGSSSRQEQEQQSDFNDNGGDSSDSHSLINE
IGRDNSIDCLIRCSRSDYGSIASLNRNFRSLVKSGEIYRLRRQNGFVEHWVYFSCQLLEW
VAFDPVERRWMQLPTMPSSVTFMCADKESLAVGTDLLVLGKDDFSSHVIYRYSLLTNSWS
SGMKMNSPRCLFGSASLGEIAIFAGGCDSQGKILDFAEMYNSELQTWITLPRMNKPRKMC
SGVFMDGKFYVIGGIGGADSKGLTCGEEYDLETKKWTQIPDLSPPRSRADQADMSPAAEA
PPLVAVVNNQLYAADHADMEVRKYDKENKKWLTVGRLPERAGSVNGWGLAFRACGERLIV
IGGPKCSGGGFIELNSWIPSDGGPPQWTLLDRKHSPTFVYNCAVMGC

Other information
Ka divergence:0.0396504KaKs divergence:0.330831
GC content 1 (%):42GC content 2 (%):44GC content divergence:0.023
Length 1 (bp):1326Length 2 (bp):1404Length divergence:0.029
MFE 1 (kcal):-415.39MFE 2 (kcal):-442.89MFE divergence0.032