Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G14350-AT2G02820
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Duplicated homeodomain-like superfamily protein
Function (paralog2):myb domain protein 88

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.13850228130573
Log2 mRNA fold difference:0.093453227294051
Log2 TE fold difference:-0.22491063316222
Sequences
Protein sequence

MEDTKKKKKKNINNNQDSKKKERHIVTWSQEEDVILREQITLHGTENWAIIASKFKDKST
RQCRRRWYTYLNSDFKRGGWSPEEDMLLCEAQRVFGNRWTEIAKVVSGRTDNAVKNRFTT
LCKKRAKHEAMTKDSNSNTKRMLFLDGISTPRKSENETPIAKKLKRSHILDLTEISNYGR
AEACVNQQIRSPFSVLARNATGIDSLEEQNQTSNVNESDGEGMFLKKDDPKVTALMQQAE
LLSSLAQKVNADNTEQSMENAWKVLQDFLNKGKENDLFRYGIPDIDFKIEEFKDLIEDLR
SGYEDNQLSWRQPDLHDSPASSEYSSGSTIMVDQSGDKTQPFSADTQTEHKQVGEELLVP
KNPDENMPISGEEKFSSPIQVTPLFRSLADGIPSPQFSESERSFLLKTLGIESSSPCPSA
NPSKPPPCKRVLLHSL

MEETTKQNNMKKKKKILLHSDDSKKKERHIVTWSPEEDDILRKQISLQGTENWAIIASKF
NDKSTRQCRRRWYTYLNSDFKRGGWSPEEDTLLCEAQRLFGNRWTEIAKVVSGRTDNAVK
NRFTTLCKKRAKHEAMAKENRIACCVNSDNKRLLFPDGISTPLKAESESPLTKKMRRSHI
PNLTEIKSYGDRSHIKVESTMNQQRRHPFSVVAHNATSSDGTEEQKQIGNVKESDGEDKS
NQEVFLKKDDSKVTALMQQAELLSSLAQKVNADNTDQSMENAWKVLQDFLNKSKENDLFR
YGIPDIDFQLDEFKDLVEDLRSSNEDSQSSWRQPDLHDSPASSEYSSGSGSGSTIMTHPS
GDKTQQLMSDTQTTSHQQNGGELLQDNGIVSDATVEQVGLLSTGHDVLKNSNETVPIPGE
EEFNSPVQVTPLFRSLAAGIPSPQFSESERNFLLKTLGVESPSPYPSANPSQPPPCKRVL
LDSL

www.000webhost.com

Other information
Ka divergence:-0.200853KaKs divergence:-0.0154394
GC content 1 (%):40GC content 2 (%):41GC content divergence:0.012
Length 1 (bp):1311Length 2 (bp):1455Length divergence:0.052
MFE 1 (kcal):-340.33MFE 2 (kcal):-413.78MFE divergence0.097