Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G14370-AT2G02800
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):protein kinase 2A
Function (paralog2):protein kinase 2B

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.6387409951444
Log2 mRNA fold difference:2.0011454120001
Log2 TE fold difference:-0.33653755377973
Sequences
Protein sequence

MGNCLDSSAKVDNSNHSPHANSASSGSKVSSKTSRSTGPSGLSTTSYSTDSSFGPLPTLR
TEGEILSSPNLKAFTFNELKNATKNFRQDNLLGEGGFGCVFKGWIDQTSLTASRPGSGIV
VAVKQLKPEGFQGHKEWLTEVNYLGQLSHPNLVLLVGYCAEGENRLLVYEFMPKGSLENH
LFRRGAQPLTWAIRMKVAVGAAKGLTFLHEAKSQVIYRDFKAANILLDADFNAKLSDFGL
AKAGPTGDNTHVSTKVIGTHGYAAPEYVATGRLTAKSDVYSFGVVLLELISGRRAMDNSN
GGNEYSLVDWATPYLGDKRKLFRIMDTKLGGQYPQKGAFTAANLALQCLNPDAKLRPKMS
EVLVTLEQLESVAKPGTKHTQMESPRFHHSSVMQKSPVRYSHDRPLLHMTPGASPLPSYT
QSPRVR

MGNCLDSSAKVDSSSHSPHANSASLSSRVSSKTSRSTVPSSLSINSYSSVESLPTPRTEG
EILSSPNLKAFTFNELKNATRNFRPDSLLGEGGFGYVFKGWIDGTTLTASKPGSGIVVAV
KKLKTEGYQGHKEWLTEVNYLGQLSHPNLVKLVGYCVEGENRLLVYEFMPKGSLENHLFR
RGAQPLTWAIRMKVAIGAAKGLTFLHDAKSQVIYRDFKAANILLDAEFNSKLSDFGLAKA
GPTGDKTHVSTQVMGTHGYAAPEYVATGRLTAKSDVYSFGVVLLELLSGRRAVDKSKVGM
EQSLVDWATPYLGDKRKLFRIMDTRLGGQYPQKGAYTAASLALQCLNPDAKLRPKMSEVL
AKLDQLESTKPGTGVGNRQAQIDSPRGSNGSIVQKSPRRYSYDRPLLHITPGASPLPTHN
HSPRVR

Other information
Ka divergence:-0.161344KaKs divergence:-0.316684
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):1281Length 2 (bp):1281Length divergence:0
MFE 1 (kcal):-366MFE 2 (kcal):-355.34MFE divergence-0.015