Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G14380-AT2G02790
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):IQ-domain 28
Function (paralog2):IQ-domain 29

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.38503062453963
Log2 mRNA fold difference:-0.59527616513661
Log2 TE fold difference:0.27526670047775
Sequences
Protein sequence

MGKTPGKWIKTLLLGKKSPKSNSDNRSQKLKSAKKEELVESVTEDLSNLTVDPPVVSSQP
VPASTAQNVVSPINGDESKDNLESRNDLGEVELEQAAIKVQATFRAHQARRAFRTLKGII
RLQAVIRGHLVRRQAIATYSCIWGIVKFQALVRGQKARSSDIAIQFQKKHMEASDSEVLQ
SSTCSWMDNPTKFVFVDKLLASSPTALPLKIQYGPEEPNSAKVWLERWTQLQVWSSGSRV
PRIEIPKSQSKKRNYQAVVEAEKKRPKRSIKKPSGTTSGTGPSRFTAERNKPKRNVRKAS
TLSKDPLRNESDKANHNSRKSRSGSKEGSPLEIKDEKPSPSLKRSSLSNGSKKATLRSAE
KKKKDIPDSSVQIQPEGKVSENVLEGGDNIEFAEKEKDTTDSVQIESEGKVSGNVLEGGE
GENIVFTEKEKDTADPVQIEPERKVLEEGDNIESSGKEKDTGDSVQIESEGKVLEGGDNI
EFGEKEKDKADAVPIEFDIVKDEKSPVLDRTEEDELKTAETSDKAEALKCADVKVSSENG
NVGSDNTKQSEKRALLPANIDKQDDGLTLSGRKIPSYMAPTASAKARVKGEASPRFAQAK
TEINGALRRHSLPSPANGKLSTTTMSPRAQKLLLASAKGSMNGDKSFTSSKDITHKSTRT
DWKR

MGKTPSPGKWIKSLLGKKSSKSSLEKGGEKLRSAKKEELVVKVKDNNVSKLPTEPPVVSS
QEVAATQTVVVPDVVIAEKQLSGDIEGDESSNVNLESGNDSEEVKLEEAATKVQAALRAQ
QAREESQNLKGITRVQAVIRGHLVRRQAVATYSCIWGIVKVQALVRGKKARSSETVAQLQ
KTNTETETSETLQGSTYSWMENPTKLSMIDKLLVSSPTTLPLKIQYSPEDPNSAKVWLGR
WTQLQVWAPGPLVVKNLVPKSQTKKRSFQAVEAEKGKLKRGVRKPTGVSTTANSSTSRST
ADNEKPKRTVRKASTLGKELSKIENDKSKQSSRKSTSAIKEGSSVEVKDEKPRISHKKAS
LSNGIGKATRKSAEKKKEIADAVQKELPIEEVSVSLVDAPEDEKMNLIPVTISKESDLDK
DEKSLVLDKPEQDELRTAERDDKAEEELKTAERDDSAEEKIQEPDAQISSENGNVASENT
KPSDRRASLPAKIENHHQDDGLTQSGRKIPSYMAPTASAKARIRGQGSPRIAQEKPEKNG
TTRRHSLPPAANGKLSTMSPRAHRLLIASAKGSMNSDRSFSSSKDIGGKRFKPITIHKPF
CQFLLHYLHPFNKFSSCLYQTSRRKLSGNGESTKAE

Other information
Ka divergence:-0.0777558KaKs divergence:-0.0939655
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):1995Length 2 (bp):1911Length divergence:-0.022
MFE 1 (kcal):-603.9MFE 2 (kcal):-542.23MFE divergence-0.054