Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G14400-AT2G02760
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ubiquitin carrier protein 1
Function (paralog2):ubiquiting-conjugating enzyme 2

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.3940372313659
Log2 mRNA fold difference:-1.2433934420809
Log2 TE fold difference:-0.17176009527739
Sequences
Protein sequence

MSTPARKRLMRDFKRLQQDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLSLQFS
EDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNS
PANSEAARMYSESKREYNRRVRDVVEQSWTAD

MSTPARKRLMRDFKRLQQDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLSLQFS
EDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNS
PANSEAARMFSESKREYNRRVREVVEQSWTAD

www.000webhost.com

Other information
Ka divergence:-1KaKs divergence:-0.987261
GC content 1 (%):47GC content 2 (%):45GC content divergence:-0.022
Length 1 (bp):459Length 2 (bp):459Length divergence:0
MFE 1 (kcal):-149.13MFE 2 (kcal):-134.3MFE divergence-0.052