Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G14410-AT2G02740
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ssDNA-binding transcriptional regulator
Function (paralog2):ssDNA-binding transcriptional regulator

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.94537042307217
Log2 mRNA fold difference:-0.27733242298204
Log2 TE fold difference:-0.31042810482016
Sequences
Protein sequence

MSQLLSTPLMAVNSNPRFLSSSSVLVTGGFAVKRHGFALKPTTKTVKLFSVKSRQTDYFE
KQRFGDSSSSPSPAEGLPARFYVGHSIYKGKAALTVDPRAPEFVALDSGAFKLSKDGFLL
LQFAPSAGVRQYDWSKKQVFSLSVTEIGTLVSLGPRESCEFFHDPFKGKSDEGKVRKVLK
VEPLPDGSGHFFNLSVQNKLVNVDESIYIPITRAEFAVLISAFNFVLPYLIGWHAFANSI
KPEETSRVNNASPNYGGDYEWNR

MSQLLSSPPMAVFSKTFINHKFSDARFLSSHSILTSGGFAGKIIPLKPTARLKLTVKSRQ
SDYFEKQRFGDSSSSQNAEVSSPRFYVGHSIYKGKAALTIEPRAPEFVALESGAFKLTKE
GFLLLQFAPAAGVRQYDWSRKQVFSLSVTEIGNLVSLGPRESCEFFHDPFKGKGSDEGKV
RKVLKVEPLPDGSGRFFNLSVQNKLLNVDESVYIPITKAEFAVLISAFNFVLPHLIGWSA
FANSIKPEDSNRLNNASPKYGGDYEWSR

Other information
Ka divergence:-0.116923KaKs divergence:0.424334
GC content 1 (%):45GC content 2 (%):43GC content divergence:-0.023
Length 1 (bp):792Length 2 (bp):807Length divergence:0.009
MFE 1 (kcal):-242.89MFE 2 (kcal):-240.42MFE divergence-0.005