Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G14440-AT2G02540
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):homeobox protein 31
Function (paralog2):homeobox protein 21

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.447563209061
Log2 mRNA fold difference:-0.35153058399369
Log2 TE fold difference:-0.92568068879202
Sequences
Protein sequence

MEIASQEDHDMPIPLNTTFGGGGSHGHMIHHHDHHAANSAPPTHNNNNTTQPPPMPLHGN
GHGNNYDHHHHQDPHHVGYNAIIKKPMIKYKECLKNHAAAMGGNATDGCGEFMPSGEDGS
IEALTCSACNCHRNFHRKEVEGELAATAMSPYHQHPPHRKLMLNHQKIRSAMPHQMIMPI
GVSNYRYMHNNSESEDFMEEDGVTTASRSLPNLPYNQKKRFRTKFTPEQKEKMLSFAEKV
GWKIQRQEDCVVQRFCEEIGVKRRVLKVWMHNNKIHFSKKNNINLEDNDNEKINNLNNVD
LSGNNDMTKIVP

MEIASQEDPIPINTSYGNSGGGHGNMNHHHHANSAPSSLNITTSNPLLVSSNSNGLGKNH
DHSHHHHVGYNIMVTNIKKEKPVVIKYKECLKNHAATMGGNAIDGCGEFMPSGEEGSIEA
LTCSVCNCHRNFHRRETEGEEKTFFSPYLNHHQPPPQQRKLMFHHKMIKSPLPQQMIMPI
GVTTAGSNSESEDLMEEEGGGSLTFRQPPPPPSPYSYGHNQKKRFRTKFTQEQKEKMISF
AERVGWKIQRQEESVVQQLCQEIGIRRRVLKVWMHNNKQNLSKKSNNVSNNVDLSAGNND
ITENLASTNP

Other information
Ka divergence:0.0977344KaKs divergence:-0.11434
GC content 1 (%):44GC content 2 (%):41GC content divergence:-0.035
Length 1 (bp):939Length 2 (bp):933Length divergence:-0.003
MFE 1 (kcal):-252.96MFE 2 (kcal):-255.3MFE divergence0.005