Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G14450-AT2G02510
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):NADH dehydrogenase (ubiquinone)s
Function (paralog2):NADH dehydrogenase (ubiquinone)s

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.065570343767
Log2 mRNA fold difference:-0.29779212819877
Log2 TE fold difference:-0.75783382842317
Sequences
Protein sequence

MAKPLGTTGEFFRRRDEWRKHPMLSNQMRHALPGLGIGVAAFCVYLVGEQIYNKALAPSK
SSHHHQEQTAPSH

MAKPLGTTGEFFRRRDEWRKHPMLSNQMRHALPGIGIGVGAFCVYLVGEQIYSKLMAPSS
QSSHQKQPAPSH

www.000webhost.com

Other information
Ka divergence:0.353018KaKs divergence:0.999856
GC content 1 (%):52GC content 2 (%):49GC content divergence:-0.03
Length 1 (bp):222Length 2 (bp):219Length divergence:-0.007
MFE 1 (kcal):-66.7MFE 2 (kcal):-62.1MFE divergence-0.036