Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G14460-AT2G02480
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):AAA-type ATPase family protein
Function (paralog2):AAA-type ATPase family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.2424053919857
Log2 mRNA fold difference:-0.18174602055154
Log2 TE fold difference:1.3770613062381
Sequences
Protein sequence

MSGLRISDPSKLHLKKELTHIRKVASKGLRDPGTTSSWKSPLTSSRFVVEPPASNNVEIL
SNNQLDSQFPSSRVFGNNGKEKEKKVFLYNWKTQRTSSEKTEGEDETSWIQASLNDDDDD
DDDVSDARNGGDSCLEETRSASMIRKSGFIKKKSKELDLSIGRKSTAKARNFPSHHLHVA
SGLSVVRDESDETEDFSNSENFPTKVSSPLLLKLKRKNWSRSSSKFLRGTSKREDSSHTC
NSTPALSTSSYNMYGIRNPSTVGSWEDGDDELDDDNLDFKGRQGCGIPFYWTKRNLKHRG
GCRSCCSPSFSDTLRRKGSSILCGSQSVYRRHRHSSGRFNKQKLALRSAKGVLPLLKYGG
DSRGGSSIGIGYSDDDLSTDFGEIDLEAQSRLDGRRWSSCCKSQDGEREEEEEGGSTPES
IQSLSQKYKPMFFDELIGQSIVVQSLMNAVKKGRVAHVYLFQGPRGTGKTSTARILSAAL
NCDVVTEEMKPCGYCKECSDYMLGKSRDLLELDAGKKNGAEKVRYLLKKLLTLAPQSSQR
YKVFVIDECHLLPSRTWLSLLKFLENPLQKFVFVCITTDLDNVPRTIQSRCQKYIFNKVR
DGDIVVRLRKIASDENLDVESQALDLIALNADGSLRDAETMLEQLSLMGKRITVDLVNEL
VGVVSDDKLLELLELALSSDTAETVKKARELLDLGADPILMMSQLASLIMDIIAGAYKAL
DEKYSEAFLDRRNLTEADLERLKHALKLLSEAEKQLRVSTDRSTWFIATLLQLGSMPSPG
TTHTGSSRRQSSRATEESISREVIAYKQRSGLQCSNTASPTSIRKSGNLVREVKLSSSSS
EVLESDTSMASHDDTTASTMTLTCRNSEKLNDIWIKCVDRCHSKTLKQLLYAHGKLLSIS
EVEGILVAYIAFGEGEIKARAERFVSSITNSIEMVLRRNVEVRIILLSETELLNSKQTRQ
IAVTTSSYTESGNEIPMKRIEAIIQEQRLETEWLQKTPGSQGRLKPERNQILPQEDTNGV
KVLKICEMGEFQENQSGKRMEHCPVSPSLLHNSNFTNNKDNLGYESESGRGVCSLLFCWN
TQKSPRRTKIKGTSMRSRRSRERRFSLFSACARPRK

MSGSRVSDLSKLHLKKELTQIRKAGRVLRDPGTTSSWKSPLDSSRSVALLETPASRNGGS
SSQFPIRGESSTNRRGKEKKVFLYNWKTQKSSSEKSGLAKNGKEEEEEEEDASSWTQASV
NDDDDVSDARNGGDSYRREIQSASMGFRCRDTNLASQGVSKMRKSNVGSCKKKSKKKISS
SRLDCLSKYQPRDDIVARNCNAGSDDTEEELSNSEDLRKVTGASPLLLKLKQKNWSRSSS
RLLRANNRKEDSSCTYNSTPALSTSSYNMYAVRNPSTVGSWDGTTTSVNDGDDELDDNLD
LPGRQGCGIPCYWTKKAMKHRGGCRSCCSPSFSDTLRRTGSSILCGSQSVYRRHNRHSSG
GYSKQKIACRSAQGVLPLLSYGGDGRGGSSLGTGLSDDELSTNYGELDLEAQSRLDGRRW
STSYRSQDGLEAVALDGEEEEGSTPETIRSFSQKYRPMFFEELIGQSIVVQSLMNAVKRS
RIAPVYLFQGPRGTGKTSTARIFSAALNCVATEEMKPCGYCKECNDFMSGKSKDFWELDG
ANKKGADKVRYLLKNLPTILPRNSSMYKVFVIDECHLLPSKTWLSFLKFLENPLQKVVFI
FITTDLENVPRTIQSRCQKFLFDKLKDSDIVVRLKKIASDENLDVDLHALDLIAMNADGS
LRDAETMLEQLSLLGKRITTALVNELVGVVSDEKLLELLELALSSDTAETVKRARELLDL
GADPIVLMSQLASLIMDIIAGTYKVVDEKYSNAFFDGRNLTEADMEGLKHALKLLSEAEK
QLRVSNDRSTWFTATLLQLGSMPSPGTTHTGSSRRQSSRATDDDPASVSREVMAYKQRIG
GLHFSKSASPASVIKRNGNHSHEAKPFSRVIDNNCYKSSSSSQMIESEGSIASHENSIAS
TMMLNQRSSEKLNDIWRKCIERCHSKTLRQLLYTHGKLISISEVEGILVAYIAFGENDIK
LRAERFLSSITNSIEMVLRRSVEVRIILLPETELLVVPHQTRKPEMTNKSGHLNNIAGLN
AETDVEVGSSVESRSKLPMQRIESIIREQRLETAWLQTADKDTPGSIIRVKPERNQILPQ
EDTYRQTNVASAISSSGLTTHQWVDELNNEVKLLKIGDNGELQENLTGTRGQHCPLSPSL
LHDTNFGNNKDNLGGYESGSGRVGCNILFCWNTKKTQRRSKSKQVKGTPVRSRRNRKSRF
SLFNGCAKPRKAEGNIRR

Other information
Ka divergence:-0.460629KaKs divergence:-0.523972
GC content 1 (%):41GC content 2 (%):42GC content divergence:0.012
Length 1 (bp):3351Length 2 (bp):3657Length divergence:0.044
MFE 1 (kcal):-995.5MFE 2 (kcal):-1098.07MFE divergence0.049