Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G14510-AT2G02470
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):alfin-like 7
Function (paralog2):alfin-like 6

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.7140813435981
Log2 mRNA fold difference:-0.50859648144955
Log2 TE fold difference:-0.18374841315648
Sequences
Protein sequence

MEGIQHPIPRTVEEVFSDFRGRRAGLIKALSTDVQKFYHQCDPEKENLCLYGLPNETWEV
NLPVEEVPPELPEPALGINFARDGMQEKDWISLVAVHSDSWLISVAFYFGARFGFGKNER
KRLFQMINDLPTIFEVVTGNAKQSKDQSANHNSSRSKSSGGKPRHSESHTKASKMSPPPR
KEDESGDEDEDDEQGAVCGACGDNYGGDEFWICCDACEKWFHGKCVKITPAKAEHIKHYK
CPSCTTSKKMKA

MEGITHPIPRTVEEVFSDFRGRRAGLIKALTNDMVKFYQTCDPEKENLCLYGLPNETWEV
NLPVEEVPPELPEPALGINFARDGMQEKDWVSLVAVHSDSWLLSVAFYFGARFGFGKNER
KRLFQMINELPTIFEVVSGNAKQSKDLSVNNNNSKSKPSGVKSRQSESLSKVAKMSSPPP
KEEEEEEDESEDESEDDEQGAVCGACGDNYGTDEFWICCDACEKWFHGKCVKITPAKAEH
IKHYKCPTCSNKRARP

www.000webhost.com

Other information
Ka divergence:0.0923861KaKs divergence:0.725442
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):759Length 2 (bp):771Length divergence:0.008
MFE 1 (kcal):-228.3MFE 2 (kcal):-229MFE divergence0.002