Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G14530-AT2G02180
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF1084)
Function (paralog2):tobamovirus multiplication protein 3

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:2.8165110124936
Log2 mRNA fold difference:3.2118223493109
Log2 TE fold difference:-0.52410406112466
Sequences
Protein sequence

MRSGGLEMMSSSAIVAFNLKEGKNWWWDVNESPVWQDRIFHVLAVLYGIVSVIAVIQLVR
IQLRVPEYGWTTQKVFHFLNFMVNGVRALVFLFRRDAQNMQPEILQHILLDIPSLAFFTT
YALLVLFWAEIYYQARAVSTDGLRPSFFTINAVVYVIQIALWLVLWWKPVHLMVIISKMF
FAGVSLFAALGFLLYGGRLFLMLQRFPVESKGRRKKLQEVGYVTTICFTCFLIRCIMMCF
DAFDDAADLDVLDHPILNFIYYLLVEILPSSLVLFILRKLPPKRGITQYHQIQ

MRIGGVEVTKFASEMMSSSSSSAVEMLNLKEASNWWSDVNESPIWQDRIFHVLAVLYGIV
SLVAVIQLVRIQLRVPEYGWTTQKVFHFLNFVVNGVRAVVFVFRRNVQFMQPEILQHILL
DIPSLAFFTTYALLVLFWAEIYYQARAVSTDGLRPSFFTINAVVYVVQIALWLVLWWKPV
RVMVILSKMFFAGVSLFAALGFLLYGGRLFLMLQRFPVESKGRRKKLQEVGYVTTICFTC
FLIRCIMMCFAAFDEGANLDVLDHPILNFIYYLLVEILPSSLVLFILRKLPPKRGITQYH
QIR

Other information
Ka divergence:-0.256667KaKs divergence:-0.123853
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):882Length 2 (bp):912Length divergence:0.017
MFE 1 (kcal):-258.14MFE 2 (kcal):-260.27MFE divergence0.004