Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G14540-AT1G14550
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Peroxidase superfamily protein
Function (paralog2):Peroxidase superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.0043378352513
Log2 mRNA fold difference:-0.77386428845978
Log2 TE fold difference:0.28741762908053
Sequences
Protein sequence

MAIFKILVLLLSLCCFSQAQLSPTFYDQTCQNALSTIRSSIRTAISRERRMAASLIRLHF
HDCFVNGCDASVMLVATPTMESERDSLANFQSARGFEVIDQAKSAVESVCPGVVSCADII
AVAARDASEYVGGPRYDVKVGRRDSTNAFRAIADRDLPNFRASLNDLSELFLRKGLNTRD
LVALSGAHTLGQAQCLTFKGRLYDNSSDIDAGFSSTRKRRCPVNGGDTTLAPLDQVTPNS
FDNNYYRNLMQKKGLLESDQVLFGTGASTDSIVTEYSRNPSRFASDFSAAMIKMGDIQTL
TGSDGQIRRICSAVN

MERFSLRFVLMMVSIILTSSICQAQLSPTFYDQSCRNALSKIRSSVRTAIARERRMAASL
IRMHFHDCFVHGCDASILLEGTSTIESERDALPNFKSVRGFEVIDKAKSEVEKVCPGIVS
CADIIAVAARDASEYVGGPKWAVKVGRRDSTAAFKALANSGELPGFKDTLDQLSGLFSKK
GLNTRDLVALSGAHTIGQSQCFLFRDRLYENSSDIDAGFASTRKRRCPTVGGDGNLAALD
LVTPNSFDNNYYKNLMQKKGLLVTDQVLFGSGASTDGIVSEYSKNRSKFAADFATAMIKM
GNIEPLTGSNGEIRKICSFVN

Other information
Ka divergence:-0.239496KaKs divergence:-0.114316
GC content 1 (%):46GC content 2 (%):45GC content divergence:-0.011
Length 1 (bp):948Length 2 (bp):966Length divergence:0.009
MFE 1 (kcal):-278.9MFE 2 (kcal):-295.82MFE divergence0.029