Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G14600-AT2G02060
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Homeodomain-like superfamily protein
Function (paralog2):Homeodomain-like superfamily protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-1.6561750931327
Log2 mRNA fold difference:-0.65254347204991
Log2 TE fold difference:-0.9954632959214
Sequences
Protein sequence

MGRCGRSNDGVIGGVRPYVRSPVPRLRWTPELHRSFVHAVDLLGGQYKATPKLVLKIMDV
KGLTISHVKSHLQMYRGSRITLLGKPEESSSPSSRRRRRQDNEEDHLHDNLSVHARNDCL
LGFHSFNFREQTSATDNDDDDFLNIMNMERTKTFAGNGESIKFQSHHSLEAENTKNIWKN
TWRENEHEEEEELSLSLSLNHPHNHQQRWKSNASSSLSETSEAVSSSSGPFIFRDCFASS
KIDLNLNLSFSLLHS

MGKSSGRNGNGSFNGNKFHGVRPYVRSPVPRLRWTPDLHRCFVHAVEILGGQHRATPKLV
LKMMDVKGLTISHVKSHLQMYRGGSKLTLEKPEESSSSSIRRRQDSEEDYYLHDNLSLHT
RNDCLLGFHSFPLSSHSSFRGGGGGRTKEQQTSESGGYDDDADFLHIKKMNDTTTFLSHH
FPKGTEEWREQEHEEEEEDLSLSLSLNHHHWRSNGSSVVSETSEAAVSTCSAPFVSKDCF
GSSKIDLNLSISLLGS

www.000webhost.com

Other information
Ka divergence:0.0541694KaKs divergence:-0.176889
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):768Length 2 (bp):771Length divergence:0.002
MFE 1 (kcal):-233.15MFE 2 (kcal):-245.36MFE divergence0.026