Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G14630-AT2G01990
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.5447997222846
Log2 mRNA fold difference:2.0773024435782
Log2 TE fold difference:-0.5586386238321
Sequences
Protein sequence

MSELSYSLPSWDLHNLGSLFNQNFNLDAWGLIDESPENIFCSPEMEIGDVSTGYLEDALI
EFSGRSKRRRLSFNGAEDKPDNDLDHSQNHWGLSENYSCTSSQFADESPNSSINICSEEK
SSISSRNSFEPSSSTSKKNDYDEKKRVVYPFGVVKPGGREEDITLNDINKRILMPSARPV
RHPVGDFACRPCVSADGPGLSGKAVVAFTKIQTLGRGTITIIRTKG

MNRSPEHIFGSPEIDYSDVSTGYLEDALIESGERSKRRRLLFEDPSKSFNDDDSQNDWGL
HESYSCLNSQFVTPHVNTGERISGVSYCQETISNVYESPDTSVSYDKIYVREKSPTEPSS
SNCGNKNKRLITKLVYPFGLVKPGGRENDVTLNDINERILMAPSRPIRHPVGDFASRPCV
SGRGPGLSGKAVVALTKIQTQGRGTITIIRTKG

www.000webhost.com

Other information
Ka divergence:-0.0117493KaKs divergence:0.999917
GC content 1 (%):44GC content 2 (%):45GC content divergence:0.011
Length 1 (bp):681Length 2 (bp):642Length divergence:-0.029
MFE 1 (kcal):-203.74MFE 2 (kcal):-185.6MFE divergence-0.047