Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G14640-AT1G14650
Species:Arabidopsis
Duplication type:TD
Function (paralog1):SWAP (Suppressor-of-White-APricot)/surp domain-containing protein
Function (paralog2):SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:4.2470924864694
Log2 mRNA fold difference:3.8209549391757
Log2 TE fold difference:0.54199914171396
Sequences
Protein sequence

MFNSMKILPLEAPPADGNLGPLPPSQLTDEEIKENEFQGEQNNSIQTPIAVATHTNPIGI
IYPPPEIRKIVETTAQFVSQNGLAFGNKVKTEKANNANFSFLKSDNPYHGFYRYKVTEYS
CHIRDGAQGTDVDDTEDPKLDDESDAKPDLQAQFRAPRKILEAPEPEKYTVRLPEGIMEA
ELDIIKHTAQFVARNGQSFLRELMRREVNNSQFQFMKPTHSMFTFFTSLVDAYSEVLMPP
RDLKEKLRKSVADLTTVLERCLNRLEWDRFQEEEKNKEEDEKEKERVQMVMIDWKDFAVV
ESIDFADEEDKDLPMPMTLEEVIRRSKVSAMEEDEIVEPGKEVEMDMDEEEVKLVAEGMR
AANLEEYVGSVEIEEEAPMRIVKNWKRPEDRFLTERDSSKVVISRITGELIPITEMSEHM
RISLIDPKFKEQKDRMFAKIRETTLAQDDEIAKNIVGLARLRPDIFGTTEEEVSNAVKAD
IEKKDEQPKQVIWDGHTGSIGRTANQALTQNSNGEQGDGVYGDPNSFPGPAAFPPPRPGV
PTVRPLPPPQNLALNLPRPPPSVQYPGAPRPLGVPMMQPMYQQHQLSMSGPHGHPSMMMS
RPPQMQPVMRVPPPPGSQFSHMQVPQPYGQLPPLSMGMMQPPPMAEMPPPPPPGEAPPPL
PEEPEPKRQKLDESALVPEDQFLAQHPGPATIRVSKPNENDGQVMEITVQSLSENVGSLK
EKIAGEMQIPANKQK

MFSSMQILPLEAPPTDGKLGPLPPSQLTDQEVEERELQAEQNNSNLAPPAAVATHTRTIG
IIHPPPDIRTIVEKTAQFVSKNGLEFEKRIIVSNEKNAKFNFLKSSDPYHAFYQHKLTEY
RAQNKDGAQGTDDSDGTTDPQLDTGAADESEAGDTQPDLQAQFRIPSKPLEAPEPEKYTV
RLPEGITGEELDIIKLTAQFVARNGKSFLTGLSNRENNNPQFHFMKPTHSMFTFFTSLVD
AYSEVLMPPKDLKEKLRKSAADLTTVLERCLHRLEWDRSQEQQKKKEEDEKELERVQMAM
IDWHDFVVVESIDFADEEDEELPPPMTLDEVIRRSKASAMEEDEIVEPGKEVEMEMDEEE
VKLVAEGMRAANLEENVKIENVHDEEAPMRIVKNWKRPEDRIPTERDPTKVVISPITGEL
IPINEMSEHMRISLIDPKFKEQKDRMFAKIRETTLAQDDEIAKNIVGLARLRPDIFGTTE
EEVSNAVKAEIEKKKDEQPKQVIWDGHTGSIGRTANQALSQNANGEEQGDGVYGDPNSFP
GPAALPPPRPGVPIVRPLPPPPNLALNLPRPPPSAQYPGAPRPLGVPMMQPMHQQHQLTM
PGPPGHPQMMMNRPPQMQPGMHVPPPPGSQFAHHMQIPRPYGQLPPSAMGMMQPPPMPGM
APPPPPEEAPPPLPEEPEAKRQKFDESALVPEDQFLAQHPGPATIRVSKPNENDGQFMEI
TVQSLSENVGSLKEKIAGEIQIPANKQKLSGKAGFLKDNMSLAHYNVGAGEILTLSLRER
GGRKR

www.000webhost.com

Other information
Ka divergence:-0.614086KaKs divergence:0.999428
GC content 1 (%):45GC content 2 (%):46GC content divergence:0.011
Length 1 (bp):2208Length 2 (bp):2358Length divergence:0.033
MFE 1 (kcal):-660.59MFE 2 (kcal):-714.02MFE divergence0.039