Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G14670-AT2G01970
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Endomembrane protein 70 protein family
Function (paralog2):Endomembrane protein 70 protein family

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.16849723164873
Log2 mRNA fold difference:-0.46030243317842
Log2 TE fold difference:0.28574851971084
Sequences
Protein sequence

MRTPTTILLLVGAILFSGAGYVRSDASDHRYKEGDTVPLYANKVGPFHNPSETYRYFDLP
FCIPEGVKEKKEALGEVLNGDRLVSAPYKLNFRDEKESEVYCNKKLSKEEVKQFRKAVEK
DYYFQMYYDDLPIWGFIGKVDKDIKSDPSEFKYFLYKHIQFEILYNKDRVIEISARMDPH
SLVDLTEDKEVDAEFMYTVKWKETETPFEKRMEKYSMSSSLPHHLEIHWFSIINSCVTVL
LLTGFLATILMRVLKNDFMKYAQDEEAADDQEETGWKYIHGDVFRFPTHNSLFAASLGSG
TQLFTLTIFIFMLALVGVFYPYNRGALFTALVVIYALTSGIAGYTSASFYCQLEGKSWVR
NLLLTGCLFCGPLFLTFCFLNTVAITYTATAALPFGTIVVIVLIWTLVTSPLLVLGGIAG
KNSKAEFQAPCRTTKYPREIPPLPWYRSAIPQMAMAGFLPFSAIYIELYYIFASVWGHRI
YTIYSILFIVFIILIIVTAFITVALTYFQLAAEDHQWWWRSFLCGGSTGLFIYAYCLYYY
YARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRAALLFVRHIYRSIKCE

MRLPTTLLLFIGALIFSGAGTVRSDASDHRYKDGDSVPLYANKVGPFHNPSETYRYFDLP
FCIPEGVKDKKEALGEVLNGDRLVSAPYKLNFRDEKDSEVYCKKKLSREEVEHFRRAVEK
DYYFQMYYDDLPIWGFIGKVDKESKSDPSEFKYFLYKHIQFEILYNKDRVIEINARMDPH
SLVDLTEDKEVDAEFMYTVKWKETETSFEKRMDKYAMSSSLPHHLEIHWFSIINSCVTVL
LLTGFLATILMRVLKNDFMKYAQDEEAADDQEETGWKYIHGDVFRFPKNKSLFAASLGSG
TQLFTLTIFIFMLSLVGVFYPYNRGALFTALVVIYALTSGIAGYTASSFYCQLEGKNWVR
NLLLTGGLFCGPLFLTFCFLNTVAIAYSATAALPFGTIIVIVLIWTLVTSPLLVLGGIAG
KNSKAEFQAPVRTTKYPREIPPLPWYRSAVPQMAMAGFLPFSAIYIELYYIFASVWGHRI
YTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYY
YARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRAALLFVRHIYRSIKCE

Other information
Ka divergence:0.0377663KaKs divergence:0.0952928
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):1779Length 2 (bp):1779Length divergence:0
MFE 1 (kcal):-516.87MFE 2 (kcal):-530.29MFE divergence0.013