Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G14685-AT2G01930
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):basic pentacysteine 2
Function (paralog2):basic pentacysteine1

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-2.1950040481283
Log2 mRNA fold difference:-0.69241190556993
Log2 TE fold difference:-1.4677066389068
Sequences
Protein sequence

MDDDGFRNWGYYEPAAATFKGNLGLQLMSTIDRNTKPFLPGRDPNLMMGPNGSYHHQEPP
IHMSYNWINQQKDKFFNMLPVTTATPNYGNVLPETSSAPSMQMNLHHHLQTEENPVKLEE
EIVVQTKKRKTNAKAGSTPKAKKPRKPKDENSNNNNNNNTNVTRVKPAKKSVDLVINGVS
MDISGLPVPICTCTGAPQQCYRWGCGGWQSACCTTNISMHPLPMSTKRRGARISGRKMSQ
GAFKKVLEKLASDGFNFGNPIDLKSHWARHGTNKFVTIR

MDDDGFRNWGYYEPAAASSFKGNLGLQLMSTIDRNTKPFLPGRESNLMIGSNGSYHSREQ
DMNYSWINQPKDNKFFNMLPISTPSYSNVLSETSGSNSIQMIHQPVLNSSRFEENPIPPP
APCEEQTGKKRKMRGSIATPTVPKAKKMRKPKEERDVTNNNVQQQQQRVKPVKKSVDLVI
NGVSMDISGLPVPVCTCTGTPQQCYRWGCGGWQSACCTTNISVYPLPMSTKRRGARISGR
KMSQGAFKKVLEKLSTEGYSFGNAIDLKSHWARHGTNKFVTIR

www.000webhost.com

Other information
Ka divergence:0.151807KaKs divergence:0.0852811
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):840Length 2 (bp):852Length divergence:0.007
MFE 1 (kcal):-247MFE 2 (kcal):-259.12MFE divergence0.024