Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G14690-AT2G01910
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):microtubule-associated protein 65-7
Function (paralog2):Microtubule associated protein (MAP65/ASE1) family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.45539106993645
Log2 mRNA fold difference:0.42905572051714
Log2 TE fold difference:0.041833873721278
Sequences
Protein sequence

MLEIESPTSLCFRTNTTCNALLRELQKIWVDIGESDAEKDRMLMELEKECLEIYRRKVDE
AANSKAQLHQSLVSIEAEIASLLAALGVFNSHSPMKAKEGSKSLKEKLAAVRPMLEDLRL
QKDERMKQFVDIKAQIEKMSGEISGYSDQLNKTMVGSLALDEQDLTLRKLNEYQTHLRSL
QKEKSDRLNKVLDYVNEVHTLCGVLGVDFGQTVSEVHPSLHRTDHEQSTNISDDTLDGLH
HMIHKLKTERSVRFQKLKDVAGSLFELWNLMDTSQEERTKFASVSYVVRSSESDITEPNI
LSSETIEQVSAEVDCFNKLKASRMKELVMKRRTELENLCRLAHIEADTSTSLEKSTALID
SGLVDPSELLTNIELHINKIKEEAHSRKEIIDRIDRWLSACEEENWLEEYNQDETRYSAG
RGGHVNLKHAERARITVNKIPSMVDNLIKKTLLWEDETRKSFLYDGVRLVSILEDYKLTR
KQQEEEKRRYRDQKKMQDLLIKRRESIYGSKPSPRRSNSVRKTNGYNGDASVPPTPRRNS
AGATNNDIMTTPRSYSSHRQNGYFKEVRRLSTAPLNFVAIPKEDSVSTYTSVCGSEPDSP
LYN

MLEIGSPNALFFRTNTTCNNLLRELQKIWVEIGETETEKDRMLMELERECLQIYQRKVDE
AANSKAKLHQSVASIEAEVASLMAALGVLNINSPIKLDKGSKSLKEKLAAVTPLVEELRI
QKEERMKQFSDIKAQIEKISGEISGYSDHLNKAMNISLTLEEQDLTLRNLNEYQTHLRTL
QKEKSDRLNKVLGYVNEVHALCGVLGVDFSQTVSAVHPSLHRTDQEQSTNISDSTLEGLE
HMIQKLKTERKSRFQKLKDVVASLFELWNLMDTPQEDRTKFGKVTYVVRSSEANITEPGI
LSTETIEQVSTEVDSLSKLKASRMKELVMKRRSELEDLCRLTHIQPDTSTSAEKSTALID
SGLVDPSELLANIEMQINKIKDEAQSRKDIMDRIDRWLSACEEENWLEEYNLDENRYSAG
RGGHVNLKRAERARVTINKIPGMVDTLIKKTLVWEEDMQKSFLYDGVRLVNILEDYKLTR
KQQEEEKKRYRDQKKRQDLLLTQRESIYGSKPSPRRSSSFRKPNGFNISNGNGSVPPTPR
RGSVGTTTPDVLLTPRSYSGHHRQNGYFKEVRRLSTTPLNYVAMQKEDTVSTTYTSIYSS
EPDSPLQG

Other information
Ka divergence:-0.242612KaKs divergence:-0.199113
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):1812Length 2 (bp):1827Length divergence:0.004
MFE 1 (kcal):-497.54MFE 2 (kcal):-488.62MFE divergence-0.009