Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G14700-AT2G01890
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):purple acid phosphatase 3
Function (paralog2):purple acid phosphatase 8

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.0261671093769
Log2 mRNA fold difference:0.23317663535885
Log2 TE fold difference:-1.2651276965602
Sequences
Protein sequence

MTYIYRDTKITTKSTIPFLIFFLFCFSNLSMATLKHKPVNLVFYVYNLIIIFSSHSSTAE
LRRLLQPSKTDGTVSFLVIGDWGRRGSYNQSQVALQMGEIGEKLDIDFVISTGDNFYDNG
LTSLHDPLFQDSFTNIYTAPSLQKPWYSVLGNHDYRGDVRAQLSPMLRALDNRWVCMRSF
IVNAEIVDLFFVDTTPFVDKYFIQPNKHVYDWSGVLPRQTYLNNLLKELDVALRESVAKW
KIVIGHHTIKSAGHHGNTIELEKHLLPILQANEVDLYVNGHDHCLEHISSVDSNIQFMTS
GGGSKAWKGGDVNYVEPEEMRFYYDGQGFMSVHVSEAELRVVFYDVFGHVLHHWKKTYKE
ALYFAS

MDSLRDVKPIKLIFSIFCLVIILSACNSTAELPRFVQPPEPDGSLSFLVVGDWGRRGSYN
QSQVALQMGKIGKDLNIDFLISTGDNFYDDGIISPYDSQFQDSFTNIYTATSLQKPWYNV
LGNHDYRGNVYAQLSPILRDLDCRWICLRSYVVNAEIVDIFFVDTTPFVDRYFDEPKDHV
YDWRGVLPRNKYLNSLLTDVDVALQESMAKWKIVVGHHTIKSAGHHGNTIELEKQLLPIL
EANEVDLYINGHDHCLEHISSINSGIQFMTSGGGSKAWKGDVNDWNPQEMRFYYDGQGFM
SVYTSEAELRVVFYDGLGHVLHRWSTLKNGVYSDI

Other information
Ka divergence:0.0968134KaKs divergence:0.559775
GC content 1 (%):41GC content 2 (%):40GC content divergence:-0.012
Length 1 (bp):1101Length 2 (bp):1008Length divergence:-0.044
MFE 1 (kcal):-305.29MFE 2 (kcal):-261.9MFE divergence-0.076