Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G14720-AT2G01850
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):xyloglucan endotransglucosylase/hydrolase 28
Function (paralog2):endoxyloglucan transferase A3

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.3071665742909
Log2 mRNA fold difference:0.90788021340901
Log2 TE fold difference:0.41032242596186
Sequences
Protein sequence

MGFITRFLVFMSLFTSLVSGFALQKLPLIQFDEGYTQLFGDQNLIVHRDGKSVRLTLDER
TGSGFVSNDIYLHGFFSSSIKLPADYSAGVVIAFYLSNGDLYEKNHDEIDFEFLGNIRGR
EWRIQTNIYGNGSTHLGREERYNLWFDPTEDFHQYSILWSLSHIIFYVDNVPIREVKRTA
SMGGDFPAKPMSLYSTIWDGSKWATDGGKYGVNYKYAPYVSQFTDLILHGCAVDPTEKFP
SCKDEAVQNLRLASEITESQRNKMEIFRQKHMTYSYCYDHMRYKVVLSECVVNPAEAKRL
RVYDPVTFGGIPHGHRRGKHRSRSRLARTESI

METLSRLLVFMSLFSGLVSGFALQNLPITSFEESYTQLFGDKNLFVHQDGKSVRLTLDER
TGSGFVSNDYYLHGFFSASIKLPSDYTAGVVVAFYMSNGDMYEKNHDEIDFEFLGNIREK
EWRVQTNIYGNGSTHSGREERYNLWFDPTEDFHQYSILWSDSHIIFFVDNVPIREVKRTA
EMGGHFPSKPMSLYTTIWDGSKWATNGGKYGVNYKYAPYIARFSDLVLHGCPVDPIEQFP
RCDEGAAEDMRAAQEITPSQRSKMDVFRRRLMTYSYCYDRARYNVALSECVVNPAEAQRL
RVYDPVRFGGIPRRHRNGKHRSKRSRVDGTESI

Other information
Ka divergence:0.141556KaKs divergence:0.245642
GC content 1 (%):44GC content 2 (%):42GC content divergence:-0.023
Length 1 (bp):999Length 2 (bp):1002Length divergence:0.001
MFE 1 (kcal):-308.04MFE 2 (kcal):-313.22MFE divergence0.008