Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G14840-AT2G01750
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):microtubule-associated proteins 70-4
Function (paralog2):microtubule-associated proteins 70-3

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.7946087620449
Log2 mRNA fold difference:-2.4482974525809
Log2 TE fold difference:0.6488685221652
Sequences
Protein sequence

MEERGFMSPSLAISASYREGGSKGMSRRRSMRPSFDADNEFMNLLHGSDPVRIELNRLEN
EVRDKDRELSEGQAEIKALRLSERQREKAVEELTEELGKMAEKLKLIENLLESKNLEIKK
INEEKKASMAAQFAAEASLRRVHAAQKDDDMPPIEAILAPLEAELKLSRQEIAKLQDDNK
SLDRLTKSKEAALLDAERTVQSALAKASMVDDLQNKNQELMKQIEICQEENRIIDKMHRQ
KVAEVEKLMQSVRELEEAVLAGGAAANAVRDYQRKFQEMNEERKILERELARAKVNANRV
ATVVANEWKDSNDKVMPVRQWLEERRFLQGEMQQLRDKLAIADRAAKSEAQLKEKFLLRL
RVLEESLKGPTSSSSRGTSVGRSSSNGPTRRQSLGGAETSPKITSNGSLIKRTPSSQLRS
LTASASTVLKHAKGTSRSFDGGTRSLDRSKVLINGPRSNFPLNHKSSEGTSRGESPSSIK
GEEESADKATNNDSVPGVLYDLLQKEVITLRKAAHEKDQSLRDKDEAIEMLAKKVETLTK
AMDVEAKKMRREVAVMGKEVAAMRVVDKGQQDSKTRRLSVSKGNTAQLLSGRVSGRIGMT
RSTQ

MEEGGYAFEVNNGRPTASEFGTTARISSPSLTMSSSFREGGGGGGSKGLTRRRSMKPSFD
ADNEFITLLHGSDPVKVELNRLENDVRDKDRELSESQAEIKALRLSERQREKAVEELTEE
LGKMSEKLKLTENLLDSKNLEIKKINEEKRASMAAQFAAEATLRRVHAAQKDDDMPPIEA
ILAPLEAELKLARHEIVKLQDDNRALDRLTKSKEAALLDAERTVQSALAKASMVDDLQNK
NQELMKQIEICQEENRILDKLHRQKVAEVEKFTQTVRELEEAVLAGGTAANAVRDYQRKF
QEMNEERRILDRELARAKVSASRVATVVANEWKDGSDKVMPVKQWLEERRFLQGEMQQLR
DKLAIADRAAKSEAQLKEKFQLRLRVLEESLRGPSSSGNRSTPEGRSMSNGPSRRQSLGG
ADIIPKLTSNGFFSKRSPSSQFRSLNASTSTILKHAKGTSRSFDGGSRSLDRSKVLTNEP
RSKFPLNQSSEGTSGGGSPNSTKQGDSEKAAGTNNDSVPGVLHDLLQKEVITLRKAANDK
DQSLRDKDEAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVSAMRVDNKGSDSRTRRH
STNSKGASTTAQLLSGSRGSGRMGMTRSTQ

www.000webhost.com

Other information
Ka divergence:-0.109039KaKs divergence:0.0360825
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):1815Length 2 (bp):1893Length divergence:0.021
MFE 1 (kcal):-518.81MFE 2 (kcal):-535.62MFE divergence0.016