Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G14860-AT2G01670
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):nudix hydrolase homolog 18
Function (paralog2):nudix hydrolase homolog 17

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.66897129281258
Log2 mRNA fold difference:0.74525070604813
Log2 TE fold difference:-0.1525358354123
Sequences
Protein sequence

MVCLVSRTGRQSQRYNKGRRQVVGCIPYRLKISSDGTISDEFEVLVISSQKGHALMFPKG
GWELDESVEEAASRESLEEAGVVGNVERQLGKWDFLSKSKGTFYEGFMFPMLVKEELELW
PEQHLRQRIWMKVDEARDACRDWWMKEALDVLVQRLSLLSLKPMEEDENLPLISIY

MGVEKMVCLASRTGRQFQRYNKGRRQVVGCVPYRFKLSNDGKISDEVEVLVISSQKGHAL
MFPKGGWELDESVEEAASRECLEEAGVLGNVEHQLGKWDFLSKSRGTYYEGLMFPMLVTE
QLELWPEQHVRQRIWMNVTEAREACRDWWMKEALDVLVERLSSPMNQPKEEKTMSISIET
MC

Other information
Ka divergence:0.113939KaKs divergence:0.434849
GC content 1 (%):43GC content 2 (%):40GC content divergence:-0.036
Length 1 (bp):531Length 2 (bp):549Length divergence:0.017
MFE 1 (kcal):-164.23MFE 2 (kcal):-155.94MFE divergence-0.026