Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G14870-AT1G14880
Species:Arabidopsis
Duplication type:TD
Function (paralog1):PLANT CADMIUM RESISTANCE 2
Function (paralog2):PLANT CADMIUM RESISTANCE 1

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-5.9458629266961
Log2 mRNA fold difference:-4.1204772557322
Log2 TE fold difference:-1.7064126416097
Sequences
Protein sequence

MEAQHLHAKPHAEGEWSTGFCDCFSDCKNCCITFWCPCITFGQVAEIVDRGSTSCGTAGA
LYALIAVVTGCACIYSCFYRGKMRAQYNIKGDDCTDCLKHFCCELCSLTQQYRELKHRGY
DMSLGWAGNVERQQNQGGVAMGAPVFQGGMTR

MEAQLHAKPHAQGEWSTGFCDCFSDCRNCCITLCCPCITFGQVAEIVDRGSKSCCAAGAL
YMLIDLITSCGRMYACFYSGKMRAQYNIKGDGCTDCLKHFCCNLCALTQQYRELKHRGFD
MSLGWAGNAEKQQNQGGVAMGAPAFQGGMTR

Other information
Ka divergence:1KaKs divergence:-0.999446
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):459Length 2 (bp):456Length divergence:-0.003
MFE 1 (kcal):-141MFE 2 (kcal):-132.69MFE divergence-0.03