Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G14890-AT2G01610
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Plant invertase/pectin methylesterase inhibitor superfamily protein
Function (paralog2):Plant invertase/pectin methylesterase inhibitor superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-4.5464413203154
Log2 mRNA fold difference:-4.2163789887128
Log2 TE fold difference:-0.36906156986253
Sequences
Protein sequence

MLTRNKEEINRVKNLKLKMGRQLYTTTVLYLVTLLFICRTISAVRFPPEQPTTDDLDFIR
TSCNTTLYPDVCYTSLAGYASAVQDNPARLAKLAIGVSLSRAKYTAAYLSKLSRRAASAA
VHDCVSNVGDAVDQMRGSLRQLREMNHRRPGDPAFRFQMSNVQTWMSAALTDEETCTDGV
TEEMEDGETKTAICDRVADVKRFTSNALALVNTYANNGA

MVTVSQSHTTTFLFFTTFLLIFGSISAVRLLPRPNTTTTNDLDFIRTSCNATLYPDVCFT
SLSGYASAVQDSPARLAKLAIGVSLSQAKSTAAFLSKLSRSAAKYSGDGHQTASAVIRDC
VSNVEDAVDEMRGSLRQLRDMNGRGGGTAARRSVETFRFQMSNVQTWMSAALTDEDTCTD
GFEDMDEGGLIKTTVCDRLEEVKRLTSNALALVNTYANNGAP

Other information
Ka divergence:0.11163KaKs divergence:-0.347939
GC content 1 (%):52GC content 2 (%):51GC content divergence:-0.01
Length 1 (bp):660Length 2 (bp):669Length divergence:0.007
MFE 1 (kcal):-217.9MFE 2 (kcal):-221.8MFE divergence0.009