Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G14910-AT2G01600
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ENTH/ANTH/VHS superfamily protein
Function (paralog2):ENTH/ANTH/VHS superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.53826453266573
Log2 mRNA fold difference:0.68560660676874
Log2 TE fold difference:-0.17373383495818
Sequences
Protein sequence

MGTLQSWRRAYGALKDTTKVGLVRVNSDYAELDVAIVKATNHVECPPKDRHLRKIFLATS
AIRPRADVAYCIHALSRRLHKTRNWTVALKALLVIHRLLRDGDPTFREELLNFSQKGRIM
QISNFKDDSSPVAWDCSGWVRTYALFLEERLECFRVLKYDIEAERLPKVSPGQEKGYSKT
RDLDGEKLLEQLPALQQLLHRLIGCKPEGAAKHNHIIQYALSLVLKESFKVYCAINEGII
NLVEKFFEMPRHEAIKALEIYKRAGLQAGNLSAFYEVCKGLELARNFQFPVLREPPQSFL
TTMEEYMRDAPQMVDVTSGPLLLTYTPDDGLTSEDVGPSHEEHETSSPSDSAVVPSEETQ
LSSQSPPSVETPQNFIDTDDLLGLHDDTPDPLAILDQNALALALVSNDVDSSPFSFGQAR
DLDPSGWELALVTTPSNDISAATERQLAGGLDTLTLNSLYDDGALRAAQQPAYGVPASNP
FEVQDLFAFSDSVSPPSAVNNPFGLYEPTYHQQEQQPQLQVAPSPANPFGDFGEFPIVPV
SEPQSTTSFGAFPVPVSEPSNTTGFGEIPVVPVTEPPNTTAFGEFPVVPVSEPQNITGFG
ALPVTPASEPSNTTGFGEFPVVSVSAPQNTTGFGALPVIPVSEPSKTTGLGEFPVVPVSE
PQNTTGFGEFPVNAGAHEQHNSNNPFGSTGFL

MGTLQSWRKAYGALKDSTKVGLVRVNSEYADLDVAIVKATNHVECPPKDRHLRKIFAATS
VTRARADVAYCIHALSRRLHKTRNWTVALKTLIVIHRLLREGDPTFREELLNFSQRGRIL
QLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDTEAERLPKSNPGQDKGYSRT
RDLDGEELLEQLPALQQLLYRLIGCRPEGAANHNHVIQYALALVLKESFKVYCAINDGII
NLIDKFFEMAKHEAITSLEIYKRAGQQARSLSDFYEACKGLELARNFQFPVLREPPQSFL
TTMEEYIKEAPRVVDVPAEPLLLTYRPDDGLTTEDTEPSHEEREMLPSDDVVVVSEETEP
SPPPPPSANAQNFIDTDDLWGLNTGAPDTSVIEDQNALALAIVSTDADPPTPHFGQPNNY
DPTGWELALVTAPSSDISASTERKLAGGLDTLTLSSLYDDGAYIASQRPVYGAPAPNPFA
SHDPFASSNGTAPPPQQQAVNNPFGAYQQTYQHQPQPTYQHQSNPPTNNSNPFGDFGEFP
VNPVSQQPNTSGYGDFSVNQHNNPFRSTGLI

Other information
Ka divergence:-0.190175KaKs divergence:-0.233583
GC content 1 (%):47GC content 2 (%):45GC content divergence:-0.022
Length 1 (bp):2079Length 2 (bp):1716Length divergence:-0.096
MFE 1 (kcal):-638.34MFE 2 (kcal):-504.62MFE divergence-0.117