Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G14920-AT2G01570
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):GRAS family transcription factor family protein
Function (paralog2):GRAS family transcription factor family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.64420725735037
Log2 mRNA fold difference:0.63962503537239
Log2 TE fold difference:-0.23022323063422
Sequences
Protein sequence

MKRDHHHHHHQDKKTMMMNEEDDGNGMDELLAVLGYKVRSSEMADVAQKLEQLEVMMSNV
QEDDLSQLATETVHYNPAELYTWLDSMLTDLNPPSSNAEYDLKAIPGDAILNQFAIDSAS
SSNQGGGGDTYTTNKRLKCSNGVVETTTATAESTRHVVLVDSQENGVRLVHALLACAEAV
QKENLTVAEALVKQIGFLAVSQIGAMRKVATYFAEALARRIYRLSPSQSPIDHSLSDTLQ
MHFYETCPYLKFAHFTANQAILEAFQGKKRVHVIDFSMSQGLQWPALMQALALRPGGPPV
FRLTGIGPPAPDNFDYLHEVGCKLAHLAEAIHVEFEYRGFVANTLADLDASMLELRPSEI
ESVAVNSVFELHKLLGRPGAIDKVLGVVNQIKPEIFTVVEQESNHNSPIFLDRFTESLHY
YSTLFDSLEGVPSGQDKVMSEVYLGKQICNVVACDGPDRVERHETLSQWRNRFGSAGFAA
AHIGSNAFKQASMLLALFNGGEGYRVEESDGCLMLGWHTRPLIATSAWKLSTN

MKRDHHQFQGRLSNHGTSSSSSSISKDKMMMVKKEEDGGGNMDDELLAVLGYKVRSSEMA
EVALKLEQLETMMSNVQEDGLSHLATDTVHYNPSELYSWLDNMLSELNPPPLPASSNGLD
PVLPSPEICGFPASDYDLKVIPGNAIYQFPAIDSSSSSNNQNKRLKSCSSPDSMVTSTST
GTQIGGVIGTTVTTTTTTTTAAGESTRSVILVDSQENGVRLVHALMACAEAIQQNNLTLA
EALVKQIGCLAVSQAGAMRKVATYFAEALARRIYRLSPPQNQIDHCLSDTLQMHFYETCP
YLKFAHFTANQAILEAFEGKKRVHVIDFSMNQGLQWPALMQALALREGGPPTFRLTGIGP
PAPDNSDHLHEVGCKLAQLAEAIHVEFEYRGFVANSLADLDASMLELRPSDTEAVAVNSV
FELHKLLGRPGGIEKVLGVVKQIKPVIFTVVEQESNHNGPVFLDRFTESLHYYSTLFDSL
EGVPNSQDKVMSEVYLGKQICNLVACEGPDRVERHETLSQWGNRFGSSGLAPAHLGSNAF
KQASMLLSVFNSGQGYRVEESNGCLMLGWHTRPLITTSAWKLSTAAY

www.000webhost.com

Other information
Ka divergence:0.0791131KaKs divergence:-0.140575
GC content 1 (%):48GC content 2 (%):46GC content divergence:-0.021
Length 1 (bp):1602Length 2 (bp):1764Length divergence:0.048
MFE 1 (kcal):-561.81MFE 2 (kcal):-609.22MFE divergence0.04