Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G14930-AT1G14940
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Polyketide cyclase/dehydrase and lipid transport superfamily protein
Function (paralog2):Polyketide cyclase/dehydrase and lipid transport superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:3.2495203909798
Log2 mRNA fold difference:1.5489653004841
Log2 TE fold difference:1.6876976759776
Sequences
Protein sequence

MAMSGKYVAEVPLKGSAEKHYRRWRSQNNLFPDAIGHHVQGVTVHDGDWDSHGSIKSWNY
TLDGKPEVIKEKREIDDEKMALTFRGLEGHVMEKYKKYEVILQFIPKSNEGCVCKVTLIW
ENRNEDSPEPINYMKFVKSLVADMDDHILKGQNKA

MAMSGTYVAEVPLKGSAEKHYKKWRNENHVFQDAVGHHIQGCTMHDGDWDSHGSIRSWNI
TCDGKPEVFKEKREIDDEKMALTLKGLEGQAMEKYKKYEVIYQFIPKSKEGCVCKITLIW
EKRNENSPEPINYMKFVKSLVADMDDHVLNGQNKA

www.000webhost.com

Other information
Ka divergence:0.376872KaKs divergence:0.99989
GC content 1 (%):50GC content 2 (%):50GC content divergence:0
Length 1 (bp):468Length 2 (bp):468Length divergence:0
MFE 1 (kcal):-149.4MFE 2 (kcal):-141.9MFE divergence-0.026