Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G14930-AT2G01520
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Polyketide cyclase/dehydrase and lipid transport superfamily protein
Function (paralog2):MLP-like protein 328

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:7.2589555253332
Log2 mRNA fold difference:8.1174186958818
Log2 TE fold difference:-0.864026257109
Sequences
Protein sequence

MAMSGKYVAEVPLKGSAEKHYRRWRSQNNLFPDAIGHHVQGVTVHDGDWDSHGSIKSWNY
TLDGKPEVIKEKREIDDEKMALTFRGLEGHVMEKYKKYEVILQFIPKSNEGCVCKVTLIW
ENRNEDSPEPINYMKFVKSLVADMDDHILKGQNKA

MATSGTYVTEVPLKGSAEKHYKRWRSENHLFPDAIGHHIQGVTIHDGEWDSHGAIKIWNY
TCDGKPEVFKERREIDDENMAVTFRGLEGHVMEQLKVYDVIFQFIQKSPDDIICKITMIW
EKQNDDMPEPSNYMKFVKSLAADMDDHVLKA

Other information
Ka divergence:0.126778KaKs divergence:0.415329
GC content 1 (%):50GC content 2 (%):49GC content divergence:-0.01
Length 1 (bp):468Length 2 (bp):456Length divergence:-0.013
MFE 1 (kcal):-149.4MFE 2 (kcal):-138.74MFE divergence-0.037