Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G14970-AT2G01480
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):O-fucosyltransferase family protein
Function (paralog2):O-fucosyltransferase family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.1425664580324
Log2 mRNA fold difference:-0.6455837593824
Log2 TE fold difference:0.49992307570084
Sequences
Protein sequence

MISQVERDLSIQNRLPGSDHTTPSPPTSPHLCRSRSKSSSVSGQQQSRNVAHRLSWIILS
VLLRRQGILLFAPIIYISCMLFHLHAASFDASPIIHRRPAPGSVYRSPQVYARLRGEIEA
DNTTADAISTIWKRSYKGVEWKPCVNMSTGVLPVSNGFIFIEANGGLNQQRTSICNAVAV
AGYLNATLVIPNFHYHSIWKDPSKFGDIYDEEYFIDTLANDVRVVDTVPEYLMERFDYNL
TNVYNFRVKAWAPTSYYRDSVLPKLLEEKVIRISPFANRLSFDAPRAVQRFRCLANNVAL
RFSKPILTQGETLVNKMKGLSANNAGKYVSVHLRFEEDMVAFSCCVFDGGDQEKQDMIAA
RERGWKGKFTKPGRVIRPGANRLNGKCPLTPLEVGLMLRGMGFNKSTYIFLAAGPIYSAN
RTMAPLLEMFPNLQTKEMLASEEDLAPFKNFSSRMAAIDYTVCLHSEVFVTTQGGNFPHF
LMGHRRYLFGGHSKTIQPDKRKLAVLFDNPKLGWKSFKRQMLSMRSHSDSKGFELKRSSD
SIYIFPCPDCMCRKNKTTASAT

MLAKNRLPGSGHTTPSPPASPRRSPRYRHGRSKAAAGSRFPTVQPSRTLAHRLSWILLSV
LLRRQGIFLFAPLIYISCMLLYMGTVSFDVVPIIQRRPPPGSVYKSPQVYAKLRPEMDAD
NSTADAITTIWKHSYKGGEWKPYVNKSTGDLPESNGYIYVEANGGLNQQRTSICNAVAVA
GYLNATLVIPNFHYHSIWRDPSKFGDIYDEEFFVSTLSNDVRVVDTIPEYLMERFDHNMT
NVYNFRVKAWSPIQYYRDSILPKLLEEKIIRISPFANRLSFDAPQAVQRLRCLANYEALK
FSKTILTLGETLVKRMKEQSANHGAKYVSVHLRFEEDMVAFSCCIFDGGNQEKQDMIAAR
ERGWKGKFTKPGRVIRPGAIRQNGKCPLTPLEVGLMLRGMGFNKSTYIFLASGEIYDANR
TMAPLLEMFPNLQTKEMLASEEELAPYKNFSSRMAAIDYTVCLHSEVFVTTQGGNFPHFL
MGHRRYMFGGHSKTIRPDKRKLAILFDNPNIGWRSFKRQMLNMRSHSDSKGFELKRPNDS
IYTFPCPDCMSRRNKTTTPESRPPPAT

Other information
Ka divergence:-0.504152KaKs divergence:-0.778653
GC content 1 (%):46GC content 2 (%):45GC content divergence:-0.011
Length 1 (bp):1689Length 2 (bp):1704Length divergence:0.004
MFE 1 (kcal):-515.74MFE 2 (kcal):-507.42MFE divergence-0.008