Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G15010-AT2G01300
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-4.4781626195167
Log2 mRNA fold difference:-2.8525727522816
Log2 TE fold difference:-2.1359282488262
Sequences
Protein sequence

MEMILISSSTLRFHPLRTSQRIATGTNRRRTTTVCADYYRGGRTVDENMVVLRKRIHEMK
MVERNFEPPSHWMQWEKRFYCNYDATICDALTLLQTFLMNSRPSVAFGTCLLLLVSVPVS
SAVFAFRILDLALWLLDAVHVV

MEATLFSSPPSISPLRFHPLVLSQRAIIPKKKKMTMRVSAAASSGKDHYYGGGRLVDENM
IVLRKRIHEMKMVERNYEPPSHWMDWEKRFYNSYDSVICDSVGLLQSFLMNSRPTVAIAT
LLFLLVSVPVSSTVIAFRLIDLLHWLLAAATSAHVA

www.000webhost.com

Other information
Ka divergence:-0.259772KaKs divergence:0.61995
GC content 1 (%):48GC content 2 (%):49GC content divergence:0.01
Length 1 (bp):429Length 2 (bp):471Length divergence:0.047
MFE 1 (kcal):-116.6MFE 2 (kcal):-146.1MFE divergence0.112