Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G15020-AT2G01270
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):quiescin-sulfhydryl oxidase 1
Function (paralog2):quiescin-sulfhydryl oxidase 2

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.8669615899425
Log2 mRNA fold difference:0.53664277448291
Log2 TE fold difference:0.40586891709748
Sequences
Protein sequence

MSLIHLFLLLGLLSLEAAASFSPGSRSILRDIGSNVADQKDNAIELNATNFDSVFQDSPA
KYAVLEFFAHWCPACRNYKPHYEKVARLFNGADAVYPGVVLMTRVDCAIKMNVKLCDKFS
INHYPMLFWAPPKRFVGGSWGPKQEKNEISVVNEWRTADLLLNWINKQIGSSYGLDDQKL
GNLLSNISDQEQISQAIFDIEEATEEAFDIILAHKAIKSSETSASFIRFLQLLVAHHPSR
RCRTGSAEILVNFDDICPSGECSYDQESGAKDSLRNFHICGKDVPRGYYRFCRGSKNETR
GFSCGLWVLMHSLSVRIEDGESQFAFTAICDFINNFFMCDDCRRHFHDMCLSVKTPFKKA
RDIALWLWSTHNKVNERLKKDEDSLGTGDPKFPKMIWPPKQLCPSCYLSSTEKNIDWDHD
QVYKFLKKYYGQKLVSVYKKNGESVSKEEVIAAAEEMAVPTNALVVPVGAALAIALASCA
FGALACYWRTQQKNRKYNYNPHYLKRYNSNYMVMNTFSNTESEREKER

MSLVHLLLFAGLVIAASSSSPGSRLILREISDQKDKAVELNTTNFDSVLKDTPAKYAVVE
FFAHWCPACRNYKPHYEKVARLFNGPDAIHPGIVLMTRVDCAMKTNTKLCDKFSVSHYPM
LFWGPPTKFVSGSWEPKKDKSEILVIDDGRTAERLLNWINKQIGSSYGLDDQKFKNEHAL
SNLTDYNQISQAVYDVEEATAEAFDIILAHKAIKSSETSASFIRFIQLLAAHHLSRRCRK
GAAEILVNYDDLCPSGNCSYEKSGGNDTLGNFPICGKDVPRGYYMFCRGSKNDTRGFSCG
LWVLMHSLSVRIEDGESHFAFTTICDFVNNFFMCDECRLHFNDMCLSVKTPFKKARDFVL
WVWSTHNKVNERLLKDEASLGTGDPKFPKIIWPPKELCPLCYLSSNQKSIEWDHEHVYKF
LKNYYGPKLVSLYKEKSVSRSKEETVSATEDLTVATNALVVPIGAALAIAIASCAFGALA
CYWRTQQKNRKPRRR

www.000webhost.com

Other information
Ka divergence:-0.0579291KaKs divergence:-0.288481
GC content 1 (%):44GC content 2 (%):45GC content divergence:0.011
Length 1 (bp):1587Length 2 (bp):1488Length divergence:-0.032
MFE 1 (kcal):-498.11MFE 2 (kcal):-459.86MFE divergence-0.04