Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G15030-AT2G01260
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF789)
Function (paralog2):Protein of unknown function (DUF789)

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.23018402939761
Log2 mRNA fold difference:-0.69998630576127
Log2 TE fold difference:0.46605149746571
Sequences
Protein sequence

MLGAGFNFTQLQRAQIDVSYGCRSSHTKDRENGSALLKHHVSEASSSNVERFLDSVTPSV
PAHYLSKTIVRERGGSDVESQVPYFLLGDVWESFAEWSAYGIGVPLTLNNNKDRVFQYYV
PSLSGIQVYADVDALTSSLQARRQGEESESDFRDSSSEGSSSESERGLCYSKEQISARMD
KLSLRKEHQEDSSSDDGEPLSSQGRLIFEYLERDLPYVREPFADKMSDLASRFPELKTLR
SCDLLPSSWFSVAWYPIYKIPTGPTLKDLDACFLTYHSLHTPFQGPGVTTGSMHVVQPRE
SVEKMELPVFGLASYKLRGSVWTSFGGSGHQLANSLFQAADNWLRLRQVNHPDFIFFCRR

MLGAGFQLTRGRHGDDPFYTSAKTRRANQRIDQLRRAQSDVSNVPSSAPSPHKQQLEPSD
LSSSNLDRFLESVTPSVPAQFLSKTLLRERRADDDYNKLVPYFVLGDIWDSFAEWSAYGT
GVPLVLNNNKDRVIQYYVPSLSAIQIYAHSHALDSSLKSRRPGDSSDSDFRDSSSDVSSD
SDSERVSARVDCISLRDQHQEDSSSDDGEPLGSQGRLMFEYLERDLPYIREPFADKVLDL
AAQFPELMTLRSCDLLRSSWFSVAWYPIYRIPTGPTLKDLDACFLTYHSLHTSFGGEGSE
QSMSLTQPRESEKMSLPVFGLASYKFRGSLWTPIGGSEHQLVNSLFQAADKWLHSCHVSH
PDFLFFCRR

Other information
Ka divergence:-0.0343538KaKs divergence:-0.415981
GC content 1 (%):45GC content 2 (%):46GC content divergence:0.011
Length 1 (bp):1083Length 2 (bp):1110Length divergence:0.012
MFE 1 (kcal):-344.96MFE 2 (kcal):-345.22MFE divergence0