Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G15100-AT2G01150
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RING-H2 finger A2A
Function (paralog2):RING-H2 finger protein 2B

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.56114877316782
Log2 mRNA fold difference:-0.10532367333186
Log2 TE fold difference:0.66127947105166
Sequences
Protein sequence

MGLQGQLSDVSSDSIPLMLLSLLAVFINHLRSFLLRLTSKSNPNLPVDDVSIASGLANII
VLADQLSLNRLFSYRCGDGGGGGSDCVVCLSKLKEGEEVRKLECRHVFHKKCLEGWLHQF
NFTCPLCRSALVSDDCVSKTQRSVGRDLISCFSLH

MGLQGQLSDVSSDSIPLMLLALLATFFRHVRSLLLFPSSAPVVVVTSNLSVLADQLNLNR
LFSYRYSDNAASDCIVCLSKLKTGEEVRKLDCRHVFHKQCLEGWLQHLNFNCPLCRSPLL
PHHHQGHGSDASISAFPLRSTSTASSH

www.000webhost.com

Other information
Ka divergence:-0.0787126KaKs divergence:0.235712
GC content 1 (%):48GC content 2 (%):51GC content divergence:0.03
Length 1 (bp):468Length 2 (bp):444Length divergence:-0.026
MFE 1 (kcal):-142.7MFE 2 (kcal):-115.48MFE divergence-0.105