Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G15120-AT2G01090
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Ubiquinol-cytochrome C reductase hinge protein
Function (paralog2):Ubiquinol-cytochrome C reductase hinge protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-3.2170559228583
Log2 mRNA fold difference:-1.8442922454045
Log2 TE fold difference:-1.3114028278015
Sequences
Protein sequence

MMSEVKEYSDKDRMPLRESRVLNGLLEFQEARESRVFNGLLKVLLPCFFESRSPLSISVF
SFQLTFNMADDEVVDPKKYLEESCKPKCVKPLLEYQACVKRIQGDDSGHKHCTGQYFDYW
QCIDKCFDTEMKLDFGSSGCTKAVCETKMKRGEAGDSIVLSLLHVV

MPEEDVVDQKRYFEESCKPKCVKPLLEYQACVKRIQDDESGHKHCTGQYFDYWHCVDKCV
SV

www.000webhost.com

Other information
Ka divergence:0.445907KaKs divergence:0.248891
GC content 1 (%):40GC content 2 (%):40GC content divergence:0
Length 1 (bp):501Length 2 (bp):189Length divergence:-0.452
MFE 1 (kcal):-145.62MFE 2 (kcal):-43.6MFE divergence-0.539