Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G15150-AT1G15160
Species:Arabidopsis
Duplication type:TD
Function (paralog1):MATE efflux family protein
Function (paralog2):MATE efflux family protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-1.2517302700313
Log2 mRNA fold difference:0.67782739111809
Log2 TE fold difference:-1.9312080816587
Sequences
Protein sequence

MQDAERTTNDPVDRIEKVTWRDLQDGSFTAELKRLICFAAPMAAVVIIQFMIQIISMVMV
GHLGRLSLASASFAVSFCNVTGFSFIIGLSCALDTLSGQAYGAKLYRKLGVQAYTAMFCL
TLVCLPLSLLWFNMGKLIVILGQDPAIAHEAGRYAAWLIPGLFAYAVLQPLIRYFKNQSL
ITPLLVTSSVVFCIHVPLCWLLVYKSGLGHIGGALALSLSYWLYAIFLGSFMYYSSACSE
TRAPLTMEIFEGVREFIKYALPSAAMLCLEWWSYELIILLSGLLPNPQLETSVLSICFET
LSITYSIPLAIAAAASTRISNELGAGNSRAAHIVVYAAMSLAVMDALMVSMSLLAGRHVF
GHVFSSDKKTIEYVAKMAPLVSISIILDSLQGVLSGVASGCGWQHIGAYINFGAFYLWGI
PIAASLAFWVHLKGVGLWIGILAGAVLQTLLLALVTGCTNWKTQAREARERMAVAHESEL
TESELPI

MEDAESTTKDPVDRVEKVTWRDLQDGSFTAELKKLICFAAPMAAVVITQSMLQIITMVIV
GHLGRLSLASASFAISFCNVTGFSFIMGLSCALDTLSGQAYGAKLYRKLGVQAYTAMFCL
TLVCLPLSLLWFNMGKLLVILGQDPSIAHEAGRFAAWLIPGLFAYAVLQPLTRYFKNQSL
ITPLLITSCVVFCLHVPLCWLLVYKSGLDHIGGALALSLSYWLYAIFLGSFMYFSSACSE
TRAPLTMEIFEGVREFIKYALPSAAMLCLEWWSYELIILLSGLLPNPQLETSVLSVCLQT
LSMTYSIPLAIAAAASTRISNELGAGNSRAAHIVVYAAMSLAVVDALMVGTSLLAGKNLL
GQVFSSDKNTIDYVAKMAPLVSISLILDSLQGVLSGVASGCGWQHIGAYINFGAFYLWGI
PIAASLAFWVHLKGVGLWIGIIAGAVLQTLLLALVTGCINWENQAREARKRMAVAHESEL
TESELPF

Other information
Ka divergence:0.225033KaKs divergence:0.531876
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):1464Length 2 (bp):1464Length divergence:0
MFE 1 (kcal):-463.02MFE 2 (kcal):-460.97MFE divergence-0.002