Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G15280-AT1G80000
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):CASC3/Barentsz eIF4AIII binding
Function (paralog2):CASC3/Barentsz eIF4AIII binding

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.04960503051772
Log2 mRNA fold difference:0.084094836649095
Log2 TE fold difference:-0.12224223120987
Sequences
Protein sequence

MATSEAEYESDPEELNRSLATRRREASDDDSDDDDAVRDVKNQRAVVDSDLSDEEVGTVK
YDNDEDGEDSYEDDEEESGGGIDNDKSGVVKEAGDMNGEEENEKEKLQAAVPTGGAFYMH
DDRFQEMSAGGNRRMRGGRRQWGSGEERKWGHDKFEEMNTGEKHSDQRMSRGRFRGHGRG
RGQGRGYARGSSSNTLTSSGQQIYVPKAVSRGRGPRKSDTPLRNENQAHSEQSKQLRNSN
GSQNSREKMPHLDSRRSPTAPAKTENQGAHAKKNVAVSSLSSASPPFYPSAPSSNVVHGI
QVSMERLHTNESVTPSGKKYRNTKSGYSPVWTAKTLQSTSQGRGAPAAGNTFYPQSHSQG
DRFSSPMQLNGDSKGTGQRPSGQGFDQHSAVVRSLSSSPQKTSLSRNRYPPDEIESSSET
AALIAKGKGTLRPGGSSSFMYSGSQMMGRPESLTSADNSNFPTFLPVMQFGGQHGGVPTF
GMAYPGYVQSEDGVRNPEMTWMPVLAGPGALGASYSPPPYAAHQAHNPGLPSSAGFSSKD
SSTNTLNDLVKPMESPEVAENGVSERQSNNPSKQPRRYSEMTFSK

MAPDGVEDSDYESDPDELNRSLATRRREASDDDEDDEEADDHDKLRAAIQIHSDEHSGVV
VVDSDDNEGLHIEDSYGDDDDEEEDGDYGQVDDHVEYIADNNDKTIVAGNGTDDSAATDL
VDGEEQKKKEPFAVPTAGAFYMHDDRFQELDAASNRRMRGGRRLWQSRDERKWGHDKFEE
MNTQKQQYDRRTSRGRGRGRGQGRGQDRGQSRGNNSKEFTGNGHQNQFPKAVTRGRGARR
YEVALRNGNQAPSVQTKQSQNSSVEVSHVDLGRPPTETATLETEAIQAKKNVFASSLNSA
SPPFYPSRSNNNLAQKDVQAGMGRLHINENPNPTGKKFGNTKSSSLWGRTAQTTSHGRGV
PPHGQVLYQQSPNQGDKVSSPMQIRGMPKGTDQSCTQLPGQVFNQHSAVISLLPSSPPKT
GSSENPYLSGEIESAVETGALVAKGKGSLQPSGRGSFMYGGTQFMGPAGMAAGHGNPNFP
AFLPVMQFGGQHGGVPTFGMALPGYFQPEHGTGNPEMTWLPILAGPGALGGSYCPPYTVL
DGSYQADKPGLPSSAGSSSQENSSNNPNDEEPMERPEVTNNGNSQRSNSNPNKQPRRYSE
MSFSK

www.000webhost.com

Other information
Ka divergence:-0.24741KaKs divergence:0.188854
GC content 1 (%):46GC content 2 (%):47GC content divergence:0.011
Length 1 (bp):1758Length 2 (bp):1818Length divergence:0.017
MFE 1 (kcal):-543.92MFE 2 (kcal):-591.2MFE divergence0.042