Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G15380-AT1G80160
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Lactoylglutathione lyase / glyoxalase I family protein
Function (paralog2):Lactoylglutathione lyase / glyoxalase I family protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-3.4471582606996
Log2 mRNA fold difference:-6.0675218955026
Log2 TE fold difference:2.7113672375227
Sequences
Protein sequence

MKEDAGNPLHLTSLNHVSVLCRSVDESMNFYQKVLGFIPIRRPESLNFEGAWLFGHGIGI
HLLCAPEPEKLPKKTAINPKDNHISFQCESMGVVEKKLEEMGIDYVRALVEEGGIQVDQL
FFHDPDGFMIEICNCDSLPVVPLVGEMARSCSRVKLHQMVQPQPQTQIHQVVYP

MKDETGNPLHIKSLNHISLLCRSVEESISFYQNVLGFLPIRRPDSFDFDGAWLFGHGIGI
HLLQSPEPEKLLKKTEINPKDNHISFQCESMEAVEKKLKEMEIEYVRAVVEEGGIQVDQL
FFHDPDAFMIEICNCDSLPVIPLAGEMARSCSRLNIRQLVQPTQIHP

www.000webhost.com

Other information
Ka divergence:-0.0274496KaKs divergence:-0.514902
GC content 1 (%):48GC content 2 (%):46GC content divergence:-0.021
Length 1 (bp):525Length 2 (bp):504Length divergence:-0.02
MFE 1 (kcal):-156.6MFE 2 (kcal):-150MFE divergence-0.022