Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G15400-AT1G80180
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-0.44118051964453
Log2 mRNA fold difference:0.22587066591521
Log2 TE fold difference:-0.68658923189842
Sequences
Protein sequence

MEGLQRSTISFRRQGSSGIVFDDRLIAELNKSGNNEQKDESQRDEQPKPMSESSEQVKPI
DEKDKLRPIKTGGGAPGGIERSRSNGGGAQRHHRTTGRVSPAVDPPSPRISSCGCCSAFG
KNPPGKKVNPRKRPPKRRSRRRIVTKKR

MAGLQRSTISFRRQGSSGIVWDDRLIAELSQQAANDRKGETLQQDEQAKLITSEVQDQTT
KPIAGEGLKPIRTDGGMERSRSNGGGAIRHHRNTGRVSPAVDPPSPRLSAFGCCSAFGKK
QPGKKVNQRKRPAKRRSR

www.000webhost.com

Other information
Ka divergence:0.172555KaKs divergence:0.775506
GC content 1 (%):50GC content 2 (%):56GC content divergence:0.057
Length 1 (bp):447Length 2 (bp):417Length divergence:-0.035
MFE 1 (kcal):-139.5MFE 2 (kcal):-153.5MFE divergence0.048