Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G15480-AT1G80270
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Tetratricopeptide repeat (TPR)-like superfamily protein
Function (paralog2):PENTATRICOPEPTIDE REPEAT 596

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.2583375881022
Log2 mRNA fold difference:1.2339456474887
Log2 TE fold difference:-0.15963761641332
Sequences
Protein sequence

MFALSKVLRRSQSLRLGACNAVYSKLDIPLGERNIAIESNALIHDKHEALPRFYELSWSS
STGRRSLSSDAGAKTTGDDDDLEDKNVDLATPDETSSDSEDGEEFSGDEGDIEGAELELH
VPESKRPSEMFKAIVSVSGLSVGSALDKWVEQGKDTNRKEFESAMLQLRKRRMFGRALQM
TEWLDENKQFEMEERDYACRLDLISKVRGWYKGEAYIKTIPESFRGELVYRTLLANHVAT
SNVRTAEAVFNKMKDLGFPLSTFTCNQMLILYKRVDKKKIADVLLLLEKENLKPNLNTYK
ILIDTKGSSNDITGMEQIVETMKSEGVELDLRARALIARHYASAGLKEKAEKVLKEMEGE
SLEENRHMCKDLLSVYGYLQREDEVRRVWKICEENPRYNEVLAAILAFGKIDKVKDAEAV
FEKVLKMSHRVSSNVYSVLLRVYVDHKMVSEGKDLVKQMSDSGCNIGALTWDAVIKLYVE
AGEVEKAESSLSKAIQSKQIKPLMSSFMYLMHEYVRRGDVHNTEKIFQRMKQAGYQSRFW
AYQTLIQAYVNAKAPAYGMKERMKADNIFPNKRLAAQLAKADPFKKTPLSDLLD

MFALSKVLRRTQRLRLGACSAVFSKDIQLGGERSFDSNSIASTKREAVPRFYEISSLSNR
ALSSSAGTKSDQEEDDLEDGFSELEGSKSGQGSTSSDEDEGKLSADEEEEEELDLIETDV
SRKTVEKKQSELFKTIVSAPGLSIGSALDKWVEEGNEITRVEIAKAMLQLRRRRMYGRAL
QMSEWLEANKKIEMTERDYASRLDLTVKIRGLEKGEACMQKIPKSFKGEVLYRTLLANCV
AAGNVKKSELVFNKMKDLGFPLSGFTCDQMLLLHKRIDRKKIADVLLLMEKENIKPSLLT
YKILIDVKGATNDISGMEQILETMKDEGVELDFQTQALTARHYSGAGLKDKAEKVLKEME
GESLEANRRAFKDLLSIYASLGREDEVKRIWKICESKPYFEESLAAIQAFGKLNKVQEAE
AIFEKIVKMDRRASSSTYSVLLRVYVDHKMLSKGKDLVKRMAESGCRIEATTWDALIKLY
VEAGEVEKADSLLDKASKQSHTKLMMNSFMYIMDEYSKRGDVHNTEKIFLKMREAGYTSR
LRQFQALMQAYINAKSPAYGMRDRLKADNIFPNKSMAAQLAQGDPFKKTAISDILD

Other information
Ka divergence:-0.173671KaKs divergence:-0.259309
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):1785Length 2 (bp):1791Length divergence:0.002
MFE 1 (kcal):-524.87MFE 2 (kcal):-523.64MFE divergence-0.001