Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G15490-AT1G80280
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):alpha/beta-Hydrolases superfamily protein
Function (paralog2):alpha/beta-Hydrolases superfamily protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:2.0772791545171
Log2 mRNA fold difference:1.5783797758127
Log2 TE fold difference:0.46941026655633
Sequences
Protein sequence

MAKSWFLVEKARRCLRTVFFMVAMLASLLVSSLPLLVAIGDVLVPSFLLSSFTCVTCYGA
KEHLRRYGFKRSLTDIPIVSVVRSFLVICIYLLSDVPALSHGPYLGTVSLCSVVSVLLLS
VKACLFTVNSQLNNEASFSPSRKRLHLKKSWGMPVLFLSSVVFALGHTVVAYRTSCRARR
KILYHRVDPEAVLSCKSIFSGHQKVPRSPTPVVGKASKFDGEARRKPLSHDEGELPVRLL
ADVDSLFVTIRGLTVHYKLCSPGSPRQSISSNVLEANSSYNTPEIMAGRSKFDRKVLSMV
TKSQHHHHHRSYNSLFNNSSLHDPLLDGSPTSPLLFKEIKEGTGLVDDMNVFNFGAEEQD
LGESGQFGVVLVHGFGGGVFSWRHVMGSLAQQLGCVVTAFDRPGWGLTARPHKNDLEERQ
LLNPYSLENQVEMLIAFCYEMGFSSVVFVGHDDGGLLALKAAQRLMATNDPIKVVVKGVV
LLNTSLSREVVPAFARILLHTSLGKKHLVRPLLRTEIAQVVNRRAWYDPAKMTTDVLRLY
KAPLHVEGWDEALHEIGRLSSEMVLAPQNAASLLKAVENLPVLVIAGAEDALVPLKSSQG
MASKLLNSRLVAISGCGHLPHEECPKALLAAMSPFITRLVIRPDLQSQ

MGKGWFMVEKARRCLRTVFFMVAMLVSLLVSSLPVLVAIGDVLVPTFLLSSFTCLTCYGF
KEHLSRYAFKSSLTDIPLVSLVRSFLVICVYSLSDAPALSHGPYLGTVSLCSVVSVVLLS
VKACVFTANSQLNDQASSSPSRQRLHLKKSWGMPVLFLSSVVFALGHMVVAYRTSCRARR
KLLYHRVDPEAVLSCKSVFSGYQKVPRSPIPLVGKASKVDGEARRKLHPSVSNDDGELPA
RLLADLDSLFITVRGLTVHYKICTPASPRHSISSSVEANSMLNMPEAMVGRLKLDRNILS
MVTRNKLNHHHHRSYSSLFNNSSSLHDPLLDGLPTSPRLFKDIQEESCREDGINVSNFGA
TEQQDVGGNGQFGVVLVHGFGGGVFSWRHVMSSLAHQLGCVVTAFDRPGWGLTARPHKKD
LEEREMPNPYTLDNQVDMLLAFCHEMGFASVVLVGHDDGGLLALKAAQRLLETKDPIKVK
GVVLLNVSLTREVVPAFARILLHTSLGKKHLVRPLLRTEIAQVVNRRAWYDPAKMTTDVL
RLYKAPLHVEGWDEALHEIGRLSSEMVLPTQNALSLLKAVENLPVLVVAGAEDALVPLKS
SQVMASKLENSRLVAISGCGHLPHEECPKALLAAMCPFISRLVFSED

Other information
Ka divergence:0.0810479KaKs divergence:0.00705128
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):1947Length 2 (bp):1944Length divergence:-0.001
MFE 1 (kcal):-626.13MFE 2 (kcal):-630.99MFE divergence0.004