Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G15550-AT1G80340
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):gibberellin 3-oxidase 1
Function (paralog2):gibberellin 3-oxidase 2

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-0.84851758601483
Log2 mRNA fold difference:-0.57511377985654
Log2 TE fold difference:-0.23355274290211
Sequences
Protein sequence

MPAMLTDVFRGHPIHLPHSHIPDFTSLRELPDSYKWTPKDDLLFSAAPSPPATGENIPLI
DLDHPDATNQIGHACRTWGAFQISNHGVPLGLLQDIEFLTGSLFGLPVQRKLKSARSETG
VSGYGVARIASFFNKQMWSEGFTITGSPLNDFRKLWPQHHLNYCDIVEEYEEHMKKLASK
LMWLALNSLGVSEEDIEWASLSSDLNWAQAALQLNHYPVCPEPDRAMGLAAHTDSTLLTI
LYQNNTAGLQVFRDDLGWVTVPPFPGSLVVNVGDLFHILSNGLFKSVLHRARVNQTRARL
SVAFLWGPQSDIKISPVPKLVSPVESPLYQSVTWKEYLRTKATHFNKALSMIRNHREE

MSSTLSDVFRSHPIHIPLSNPPDFKSLPDSYTWTPKDDLLFSASASDETLPLIDLSDIHV
ATLVGHACTTWGAFQITNHGVPSRLLDDIEFLTGSLFRLPVQRKLKAARSENGVSGYGVA
RIASFFNKKMWSEGFTVIGSPLHDFRKLWPSHHLKYCEIIEEYEEHMQKLAAKLMWFALG
SLGVEEKDIQWAGPNSDFQGTQAVIQLNHYPKCPEPDRAMGLAAHTDSTLMTILYQNNTA
GLQVFRDDVGWVTAPPVPGSLVVNVGDLLHILTNGIFPSVLHRARVNHVRSRFSMAYLWG
PPSDIMISPLPKLVDPLQSPLYPSLTWKQYLATKATHFNQSLSIIRN

www.000webhost.com

Other information
Ka divergence:0.131738KaKs divergence:0.37489
GC content 1 (%):49GC content 2 (%):50GC content divergence:0.01
Length 1 (bp):1077Length 2 (bp):1044Length divergence:-0.016
MFE 1 (kcal):-321.48MFE 2 (kcal):-292.33MFE divergence-0.047