Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G15570-AT1G80370
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):CYCLIN A2;3
Function (paralog2):Cyclin A2;4

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.36713778078152
Log2 mRNA fold difference:-0.50817092858511
Log2 TE fold difference:0.14704950898859
Sequences
Protein sequence

MGKENAVSRPFTRSLASALRASEVTSTTQNQQRVNTKRPALEDTRATGPNKRKKRAVLGE
ITNVNSNTAILEAKNSKQIKKGRGHGLASTSQLATSVTSEVTDLQSRTDAKVEVASNTAG
NLSVSKGTDNTADNCIEIWNSRLPPRPLGRSASTAEKSAVIGSSTVPDIPKFVDIDSDDK
DPLLCCLYAPEIHYNLRVSELKRRPLPDFMERIQKDVTQSMRGILVDWLVEVSEEYTLAS
DTLYLTVYLIDWFLHGNYVQRQQLQLLGITCMLIASKYEEISAPRIEEFCFITDNTYTRD
QVLEMENQVLKHFSFQIYTPTPKTFLRRFLRAAQASRLSPSLEVEFLASYLTELTLIDYH
FLKFLPSVVAASAVFLAKWTMDQSNHPWNPTLEHYTTYKASDLKASVHALQDLQLNTKGC
PLSAIRMKYRQEKYKSVAVLTSPKLLDTLF

MGKENAVSGNSIPIHGRPVTRALASALRASSKLITSSEVAATTQNQGRVLRAKSKRTALD
EKKANAPKKRAVLKDITNVTCENSYTSCFSVAVENIKQIKKGRQSSSSSKVASSSATSQV
TDAKVEVVSNSAGASLSVFTDTSLGTNETSYSIIAKPSSRSPPRPFGTVERSCGGASSPK
FVDIDSDDKDPLLCSLYAPDIYYNLRVAELKRRPFPDFMEKTQRDVTETMRGILVDWLVE
VSEEYTLVPDTLYLTVYLIDWFLHGNYVERQRLQLLGITCMLIASKYEEIHAPRIEEFCF
ITDNTYTRDQVLEMESQVLKHFSFQIYTPTSKTFLRRFLRAAQVSFPNQSLEMEFLANYL
TELTLMDYPFLKFLPSIIAASAVFLAKWTLNQSSHPWNPTLEHYTTYKASDLKASVHALQ
DLQLNTKGCSLNSIRMKYRQDKFKSVAVFSSGELPDKLFIS

www.000webhost.com

Other information
Ka divergence:-0.133282KaKs divergence:-0.211655
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):1353Length 2 (bp):1386Length divergence:0.012
MFE 1 (kcal):-378.85MFE 2 (kcal):-397.25MFE divergence0.024