Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G15670-AT1G80440
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Galactose oxidase/kelch repeat superfamily protein
Function (paralog2):Galactose oxidase/kelch repeat superfamily protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-2.2947301938685
Log2 mRNA fold difference:-2.9251161044735
Log2 TE fold difference:0.63813165139057
Sequences
Protein sequence

MELIPDLPETVAYECLLRSSYKQFPLMASVCKLWQREISLSDFFRHRKASGHSQELVVLS
QARVDPVKELVSGNKTIPTPVYRISVLELGTGLRSELPPVPGHSNGLPLFCRLVSVGSDL
VVLCGLDPVTWRTSDSVFVFSFLTSTWRVGKSMPGGPRSFFACASDSQRNVFVAGGHDED
KNAMMSALVYDVAEDRWAFLPDMGRERDECTAIFHAGKFHVIGGYSTEEQGQFSKTAESF
DVTTWRWSPQGEEFLSSEMTMWPPICAAGENGDLYACCRRDLMMMKDDTWYKVGNLPADV
CNVSYVAIRRSGNLVVIGSARYGEPSVGYNWDMSNSRWLKLETHDKYEGHVQAGCFLEI

MELIPNLPDDVARECLLRSSYQQFPVIASVCRAWNREVSLSQFLHQRKASRHSQELLILS
QARVDPAGSGKIIATPEYRISVLESGSGLWTELPPIPGQTKGLPLFCRLVSVGSDLIVLG
GLDPITWQAHDSVFVFSFLTSKWRVGATMPGVRRSFFGCASDSDRTVLVAGGHNEEKCAL
TSAMVYDVSEDKWTFLPDMARERDECKAVFHAGRFHVIGGYATEEQGQFSKTAESFDVST
WEWGPLTEDFLDDTGDTVSPPTCVAGGDLYACWGGDVMMFLNDKWQKVGQIPADVYNVTY
VAVRPGMLIVIGNGKALAGYGEATVGYICDLSSSRWVKLETHGGHVQAGCFLEV

www.000webhost.com

Other information
Ka divergence:-0.103706KaKs divergence:-0.0919715
GC content 1 (%):50GC content 2 (%):53GC content divergence:0.029
Length 1 (bp):1080Length 2 (bp):1065Length divergence:-0.007
MFE 1 (kcal):-379.9MFE 2 (kcal):-390.2MFE divergence0.013