Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G15730-AT1G80480
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Cobalamin biosynthesis CobW-like protein
Function (paralog2):plastid transcriptionally active 17

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.61164526898132
Log2 mRNA fold difference:0.32102215004544
Log2 TE fold difference:0.13154799652175
Sequences
Protein sequence

MATLLKLDIATTFLAFIVPRANTSLNHRFASARLSTATVSLRTKSSSFYSAALYSDSRRR
FHSAVASDSSLAVVDDEDIFDVASEILPDNRIPATIITGFLGSGKTTLLNHILTGDHGKR
IAVIENEFGEVDIDGSLVAAQTAGAEDIMMLNNGCLCCTVRGDLVRMISEMVQTKKGRFD
HIVIETTGLANPAPIIQTFYAEDEIFNDVKLDGVVTLVDAKHARLHLDEVKPEGYVNEAV
EQIAYADRIIVNKTDLVGEPELASVMQRIKTINSMAHMKRTKYGKVDLDYVLGIGGFDLE
RIESSVNEEEKEDREGHDDHHHGHDCHDHHNEHEHEHEHEHHHSHDHTHDPGVGSVSIVC
EGDLDLEKANMWLGALLYQRSEDIYRMKGILSVQDMDERFVFQGVHEIFEGSPDRLWRKD
ETRTNKIVFIGKNLNREELEMGFRACLI

MATLSTLEIATTFLSFTAPRSSAAFNYRFSSAAVSVLSRPRATTVSVRTTPSFFYSPVVR
RQRFSSVSASATQTEDSDVTTKIPPDNRIPATIITGFLGSGKTTLLNHILTRDHGKRIAV
IENEFGEVDIDGSLVASKSIGAEDIVMLNNGCLCCTVRGDLVRMIGELVNTKKGKFDHIV
IETTGLANPAPIIQTFYAEEEIFNDVKLDGVVTLVDAKHARLHLDEVKPEGVVNEAVEQI
AYADRIIVNKTDLVGEAELGSVVQRIKTINSMAQMTRTKYGNVDLDYVLGIGGFDLERIE
SSVNEDDKGDHHDHDHDHHHDHNHDHDHHHHDGHDHHHHSHDHTHDPGVSSVSIVCEGSL
DLEKANMWLGTLLMERSEDIYRMKGLLSVHTMEERFVFQGVHDIFQGSPDRLWGREEERV
NKIVFIGKNLNREELEKGFKACLI

Other information
Ka divergence:-0.269164KaKs divergence:-0.321073
GC content 1 (%):46GC content 2 (%):45GC content divergence:-0.011
Length 1 (bp):1347Length 2 (bp):1335Length divergence:-0.004
MFE 1 (kcal):-437.1MFE 2 (kcal):-412.2MFE divergence-0.029