Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G15750-AT1G80490
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Transducin family protein / WD-40 repeat family protein
Function (paralog2):TOPLESS-related 1

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.6014177178715
Log2 mRNA fold difference:-1.0752820491263
Log2 TE fold difference:-0.51853032204077
Sequences
Protein sequence

MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF
TKVDDNRYSMKIFFEIRKQKYLEALDKHDRPKAVDILVKDLKVFSTFNEELFKEITQLLT
LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPTLRNSRLRTLINQSLN
WQHQLCKNPRPNPDIKTLFVDHSCGPPNGARAPSPVNNPLLGGIPKAGGFPPLGAHGPFQ
PTASPVPTPLAGWMSSPSSVPHPAVSAGAIALGGPSIPAALKHPRTPPTNASLDYPSADS
EHVSKRTRPMGISDEVNLGVNMLPMSFSGQAHGHSPAFKAPDDLPKTVARTLSQGSSPMS
MDFHPIKQTLLLVGTNVGDIGLWEVGSRERLVQKTFKVWDLSKCSMPLQAALVKEPVVSV
NRVIWSPDGSLFGVAYSRHIVQLYSYHGGEDMRQHLEIDAHVGGVNDISFSTPNKQLCVI
TCGDDKTIKVWDAATGVKRHTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDNM
GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESFIVEWNESEGAVKRTYQGFHKRSL
GVVQFDTTKNRYLAAGDDFSIKFWDMDAVQLLTAIDGDGGLQASPRIRFNKEGSLLAVSG
NENVIKIMANSDGLRLLHTFENISSESSKPAINSIAAAAAAAATSAGHADRSANVVSIQG
MNGDSRNMVDVKPVITEESNDKSKIWKLTEVSEPSQCRSLRLPENLRVAKISRLIFTNSG
NAILALASNAIHLLWKWQRNERNATGKATASLPPQQWQPASGILMTNDVAETNPEEAVPC
FALSKNDSYVMSASGGKISLFNMMTFKTMATFMPPPPAATFLAFHPQDNNIIAIGMDDST
IQIYNVRVDEVKSKLKGHSKRITGLAFSNVLNVLVSSGADAQLCVWNTDGWEKQRSKVLP
LPQGRPNSAPSDTRVQFHQDQAHFLVVHETQLAIYETTKLECMKQWAVRESLAPITHATF
SCDSQLVYASFMDATVCVFSSANLRLRCRVNPSAYLPASLSNSNVHPLVIAAHPQEPNMF
AVGLSDGGVHIFEPLESEGKWGVAPPAENGSASGAPTAPSVGASASDQPQR

MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF
TKVDDNRYSMKIFFEIRKQKYLEALDRHDRPKAVDILVKDLKVFSTFNEELFKEITQLLT
LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPTLRTSRLRTLINQSLN
WQHQLCKNPRPNPDIKTLFVDHSCRLPNDARAPSPVNNPLLGSLPKAEGFPPLGAHGPFQ
PTPSPVPTPLAGWMSSPSSVPHPAVSGGPIALGAPSIQAALKHPRTPPSNSAVDYPSGDS
DHVSKRTRPMGISDEVSLGVNMLPMTFPGQAHGHNQTFKAPDDLPKTVARTLSQGSSPMS
MDFHPIKQTLLLVGTNVGDIGLWEVGSRERLVQKTFKVWDLSKCSMPLQAALVKEPVVSV
NRVIWSPDGSLFGVAYSRHIVQLYSYHGGEDMRQHLEIDAHVGGVNDIAFSTPNKQLCVT
TCGDDKTIKVWDAATGVKRYTFEGHEAPVYSICPHYKENIQFIFSTALDGKIKAWLYDNM
GSRVDYEAPGRWCTTMAYSADGTRLFSCGTSKDGESFIVEWNESEGAVKRTYQGFHKRSL
GVVQFDTTKNRYLAAGDDFSIKFWDMDTIQLLTAIDADGGLQASPRIRFNKEGSLLAVSA
NDNMIKVMANSDGLRLLHTVENLSSESSKPAINSIPMVERPASVVSIPGMNGDSRNMVDV
KPVITEESNDKSKVWKLTEVGEPSQCRSLRLPENMRVTKISRLIFTNSGNAILALASNAI
HLLWKWQRNDRNATGKATASLPPQQWQPASGILMTNDVAETNPEEAVPCFALSKNDSYVM
SASGGKISLFNMMTFKTMATFMPPPPAATFLAFHPQDNNIIAIGMDDSTIQIYNVRVDEV
KSKLKGHSKRITGLAFSNVLNVLVSSGADAQLCVWNTDGWEKQKSKVLQIPQGRSTSSLS
DTRVQFHQDQVHFLVVHETQLAIYETTKLECMKQWPVRESAAPITHATFSCDSQLIYTSF
MDATICVFSSANLRLRCRVNPSAYLPASLSNSNVHPLVIAAHPQESNMFAVGLSDGGVHI
FEPLESEGKWGVAPPPENGSASAVTATPSVGASASDQPQR

Other information
Ka divergence:-0.135748KaKs divergence:-0.999603
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):3396Length 2 (bp):3363Length divergence:-0.005
MFE 1 (kcal):-1077.64MFE 2 (kcal):-1050.56MFE divergence-0.013