Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G15760-AT1G80520
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Sterile alpha motif (SAM) domain-containing protein
Function (paralog2):Sterile alpha motif (SAM) domain-containing protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:0.41012517081009
Log2 mRNA fold difference:1.2800043376628
Log2 TE fold difference:-0.96861209641129
Sequences
Protein sequence

MEDWWFSWLSRTNLEPSLIHEYGLSFSQNELEHEDISYFDHEFLQSMGISIAKHRLEILK
LARRDRKNSPPLTSRSISRVVTAIKKTRKCLSDHVRAWIRREEESASSRALVLVPKKTSN
GIGKWRGGFLKRNKRSVMPSNGNGGLEKQERLLLTNGTPCRIDSFSSPMVFDYSFKDEKL
YAQDTYFEDIKWDSMFQNLKPT

MDWFSWLSRTNLEASLIYEYGLSFSNNELEYEDIAYFNHEFLQSMGISIAKHRLEILKLA
RRDRKPSPLTARSIFRVLIAIKKTGKCFSEHVRAWIRREESSRALVVVSRSTSSSGNGRW
KSARKKRLVMPSNGNGVKEERLLLTNGTPCRLDSFSNPKVSSGYEDDDNHWGNKDVEEKI
KWDSMFQNLKPT

www.000webhost.com

Other information
Ka divergence:-0.0805165KaKs divergence:-0.163612
GC content 1 (%):46GC content 2 (%):48GC content divergence:0.021
Length 1 (bp):609Length 2 (bp):579Length divergence:-0.025
MFE 1 (kcal):-190.7MFE 2 (kcal):-187.6MFE divergence-0.008