Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G15800-AT1G80610
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.33153711216706
Log2 mRNA fold difference:-1.1079425088815
Log2 TE fold difference:1.3622659539091
Sequences
Protein sequence

MTGGDWIHEAMGDDSLVAEALICLLHAEPSLPETKSGGASDLKLKWSVRQPRTKAATLRK
KGDHDTRASPTTPLSWSGATSFSGGGGGAAAAVDGFEESSGVVKLSEAVRSKITQTSVTT
SPFKRSRKKKTLAQLKEEESVLLKERNGLRNELATMQDLLKQQRARNESLKKLQAESQKN
DDSSFLLPDLNIALDNNSSPESLYGTS

MSGENWIRVAMSDDSMVAEALLRLRHSEPKNRVDASPLKLKWSVRQRRSKKGDQTRASPT
TPLSWSGATSLSGGGGSGGSGAGATTMEGLEESSAAVKPSEPFRSKISQTSAITTTTTTT
LFKRSRKKKTLAELKEEEIMLLKESNGLKNELANMRDLLEQQRARNTALKKMKAESQSAL
SCKLTFEQGSSFLLPDLNMPLDNDPSPEVVC

www.000webhost.com

Other information
Ka divergence:-0.241556KaKs divergence:-0.145889
GC content 1 (%):50GC content 2 (%):51GC content divergence:0.01
Length 1 (bp):624Length 2 (bp):636Length divergence:0.01
MFE 1 (kcal):-212.7MFE 2 (kcal):-201.18MFE divergence-0.028