Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G15870-AT1G80720
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Mitochondrial glycoprotein family protein
Function (paralog2):Mitochondrial glycoprotein family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.22127213162363
Log2 mRNA fold difference:1.4430430278471
Log2 TE fold difference:-1.152507509112
Sequences
Protein sequence

MARLLRCLRRSFIFSSSTSIAYRNPRICVQSNQSYIFLSSRKFLSSGSYVSEMRRTAFEG
NILRLIRLEIQSELDHSPILQPEESFGPFTVDERPGEQWISLRRKFGEKEDIKIEATMFD
GSVPSSKSTTSDPEDVQLHITFIVNISKGDGETLEIMCSAWPDTIQITKFFVRKSSQNSP
NAYIGPEFQEMEDELQDSVYRFLEERGISDDLAEFLHQYMKNKDKAEYIRWMETVKSYVE
QK

MQKSAFQGNILRLIRNEIEYELDHSPPLQPPNSFGPFTVDERPGEQWISLKRNFGDKEDI
KIEATMFDRSVPTSKSTKTEPEYILHITFIVNISKAGATEALEIMCSAWPDTIEISKLCI
RRGINTSPSSYGGPEFEELDDQLQDALYQFLEERGISDELAVFLHRYMKNKGKAEYVRWM
ESVKSYVEQK

www.000webhost.com

Other information
Ka divergence:-0.00418436KaKs divergence:0.999723
GC content 1 (%):41GC content 2 (%):42GC content divergence:0.012
Length 1 (bp):729Length 2 (bp):573Length divergence:-0.12
MFE 1 (kcal):-207.64MFE 2 (kcal):-151.96MFE divergence-0.155